SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008642 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008642
Domain Number 1 Region: 130-336
Classification Level Classification E-value
Superfamily vWA-like 6.5e-58
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 1010-1210
Classification Level Classification E-value
Superfamily vWA-like 1.91e-54
Family Integrin A (or I) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 1228-1429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-24
Family Laminin G-like module 0.063
Further Details:      
 
Domain Number 4 Region: 541-700
Classification Level Classification E-value
Superfamily Fibronectin type III 4.06e-21
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 738-909
Classification Level Classification E-value
Superfamily Fibronectin type III 5.63e-21
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 6 Region: 358-445
Classification Level Classification E-value
Superfamily Fibronectin type III 1.3e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 449-537
Classification Level Classification E-value
Superfamily Fibronectin type III 2.7e-17
Family Fibronectin type III 0.00099
Further Details:      
 
Domain Number 8 Region: 32-116
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000413
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 9 Region: 921-1005
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000307
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008642   Gene: ENSTNIG00000005915   Transcript: ENSTNIT00000008810
Sequence length 1771
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:82064249:82083176:-1 gene:ENSTNIG00000005915 transcript:ENSTNIT00000008810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSGWMKMWFWVALVRCLPLIWALPQTARGQVSSPRRFRAKVLGPSQLQVWWKEPRGEFD
GYSVIYATVPGGGEPREVQVSKREAKLLIQDFDPSKDYLFQILAVRGGQQSKPLQASHQA
VDLSSGQEPPRSGSKHQRGFSHPSFPEPFVCQTEAVADMVFLVDGSWSIGRTNFRLVRVF
LESLVKAFDVDLDRTRIGLAQFSGEPRIEWHLNTHTTKEAVMEAARNLPYKGGNTLTGLA
LTFILENSFSPESGSRPGIPKIGVLLTDGKSQDDVIPPAQRLRDAGVEVFAIGVKNADEG
ELRAIASVSEDTHVYNVADFHLMADIVDVLTRTICERMETLHKQIAGRVDSAPPAAAVSP
PSDLRVSEVTAHSFRVSWTQAPGQVEKYRVVYYPASGGQPEEKVVPGTETSVLLTYLNSL
TEYQLAVFSVHHSSASQALRGGATTLALPTVDHLQLLHITHSSMLVRWTPAPGASGYMVL
YAPLSQEEPADEKEVKVDGSPTEVELSHLTPATEYTVTVYAMFGEEASDPVSSQQTTLPL
SPAANLRLSDVSHSSAQLTWEPASSQVSGYRVAYVQADGARTSQVDVGHVTSWLLSNLSP
LTEYTVGVVALYDEGQADAATDSFTTKAVPEPLDFRSSQVSADGFRVSWEPPAPDVLLYR
LTWSPADGGPSQEALLQGGTTSHVLTGLRPGQYQVLLAATYGEELESQQLVLVQSTATFT
TTVATTTSSTEAPDLALRELRLQEKTPFSIHLSWQPPHTSTLQHYRLSYSRTGGAEETVS
GRRRLPADQTTVVLQPLLADSEYRFHVTPVYLHGDGPTSTLMERTLPLSAPENLQVSEEW
YNRFRISWDAPPSPTLGYRIIYQPHSPPGAALETFVGEGVTSMLLVNVLSGTEYIVTVTA
SYSSGASQPLSGRARTLFLGVSHLLSYQVRTTSLCVQWQPQRHASTYRLLTESLPSGQKQ
EVRLSGATSRHCFNQLEPNTQYSVSVHAQLADGSEGPAVTVTESTRSISTRVTFADLLCP
IRPVCRAARADLAFLVDGSWSIGDDNFLKITRFLYSAVGALDRIGPEGTQVAIVQFSDEP
RTEVQLKSYRKKERLLEAISSISYKGGNTKTGRAIQHMKDSVFTEEGGARTAVPKVLVLL
TDGRSQDDVSKVSKELQKQGFVVFAIGFADADYGELVNVASKPSSTHVFFVDDLDAFKEM
EEELVASVCEAASATCPSAAMSDSATPAFRMMELFGLVESRYSNVSGVSMVPGTFNSFPS
FQLQADALLAQPTRRLLHPQGLPSDYTITLLFRLLADAPQEPFALWEVLDRKREPLVGVV
LDNGGKTLTFFNSDQEGVVQAVTFEGAHIQKLFYGSFHKLHVAVSQTSAKVAIDCRTVAE
KSIRAAGNISTDGVEVLGRMVRSTGTGDRSAPPSSRCRLLDISCGTSWAGRDRCCELPGL
RKEADCPALPKACTCTQDSLWSSVSHTGGPGIRGARGDRGEPGPVKGPAGPVGETGVPGP
QGPQGPQGPSGRSIMGPMGGPGERGQKGEPGHQGAQGLPGQAGAAGRDGPPGPRGLPGKD
GPQGRPGSPWNHGGTPGAPGAPGTTGPTGKQGDLGPPGLPGGKGEKGERGDVQSAVAVQA
IARQVCEQLIQSHMARYSAVLSQVPSPPVSVRTVPGPPGEPGRPGSPGTQGEQGPAGRPG
FPGQNGQNGQPGERGPPGEKGEKGSQGVGLQGPRGPPGPPGVPGQGRPGSQGSSGRPGNP
GPPGRPGVPGPVGSSGPPGYCDPNSCVGYNV
Download sequence
Identical sequences H3CK63
ENSTNIP00000008642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]