SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008663 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008663
Domain Number 1 Region: 41-104
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.23e-16
Family TB module/8-cys domain 0.00037
Further Details:      
 
Domain Number 2 Region: 151-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 3 Region: 118-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008663   Gene: ENSTNIG00000005930   Transcript: ENSTNIT00000008832
Sequence length 219
Comment pep:novel chromosome:TETRAODON8:Un_random:82351706:82352764:-1 gene:ENSTNIG00000005930 transcript:ENSTNIT00000008832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFMCECDRTGYEFDASRRECVRTHTSSSQAPPPLPPARPGEVRECYHHLAEGGGCSLLAA
NSSQQECCCTVGEGWGLGCRYHTCPSADSADFLSLCPIGRGYTVLYYLTHVDECQLFHPN
VCKNGVCVNNVPGYSCYCTSGYVYNSSLLECVDHDECEEESCVGGACVNTLGSYYCSCPP
PLVLDDAQRTCVNSSHLAVGESRSRPRFWPRPRPRSRPC
Download sequence
Identical sequences H3CK84
ENSTNIP00000008663 ENSTNIP00000008663 99883.ENSTNIP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]