SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008675 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008675
Domain Number 1 Region: 5-68,109-164
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.81e-16
Family NAD kinase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008675   Gene: ENSTNIG00000005940   Transcript: ENSTNIT00000008844
Sequence length 283
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:82858061:82861064:-1 gene:ENSTNIG00000005940 transcript:ENSTNIT00000008844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVLAVSSSTSRDKPVVGVNTDPERSQGHLCLPVRYTRAFPEALEKLARGEFRWLWRQRIR
LHLEGTGINPTPVDLHEQQLSLEQHSRAHRITTLQHRRRGPAEKSSEPRLLPVRGLNEIF
IGESLSSRASYYEISVDGGPWEKQKSSGLSICTGTGSKAWSYNINKLGEQAVEEILTTGR
SQAGTQLPLDRSFIQAVTERYNASLVFPPADGRLLFSVREPIVNRVFFSSRQRGFASRLC
VRSRCWDACMVVDGGTSFEFNDGAIATISTSEEDRLRTVVLDG
Download sequence
Identical sequences H3CK96
ENSTNIP00000008675 ENSTNIP00000008675 99883.ENSTNIP00000008675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]