SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008695 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008695
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-40
Family Laminin G-like module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008695   Gene: ENSTNIG00000013443   Transcript: ENSTNIT00000008865
Sequence length 1758
Comment pep:known_by_projection chromosome:TETRAODON8:4:5585089:5622271:-1 gene:ENSTNIG00000013443 transcript:ENSTNIT00000008865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEPADLLKILDFHNLPEGVTRTTGFCSHRRSAQGADVAYRVSKNAQLSAPTKQMYPGDA
FPEDFSILALVKPKKGSQSFLLSVYNEQGIQQLGLEVGRSPVFLYEDHTGRPSPEDYPLF
RGVNLADGKWHRVAISVHKQTVTLILDCKKKTTQKLLRSPSPIIDTKGIVVFGTRILDEE
VFEGDIQQLMIVSDHRAAYDYCEHYSPDCDVPAPEQPQNQDPNTDEYNPDGNYYYEYPYY
DDGDDKPKPSHTGINLTSYTGKVTSTSTRASSGGTGSSSSSSSSTATGEETSLNGNDYDY
NYNYESYDDTTALPDEDTSRRVTISTDSGAELDLELKEKTDPAPGTGMHFSTSDLGTSVT
INQNKTELLSGGVDGGGSSSSVVIGTGANTDSSTILFDGARGEKGQKGEPAVIEPGMLVE
GPPGPEGPTGLPGPPGSSGPPGTPGDPGERGPPGRPGLPGADGLPGPPGTVLMLPVRFAS
FAPNCLHRCETCGQQSRLAEPSEHFVKGLMMHSNITAGIIKGVKKDHAALWDPPGPTGKP
GRRGRPGADGARGMPGQSGPKGDRGFDGLAGLPGEKGYRGESGPSGPPGAPGEDGERGDD
GEIGPRGLPGEPGPRGLLGPKGPQGPPGPPGVTGMDGPSGLKGSIGPQGEPGPPGQQGNP
GAQGLPGPQGAIGPPGDKIPLHYPRGSIPGCDGFTXPPMCCYKLQGPNKDLSPQGPPGPQ
GPIGYPGPRGVKGADGVRGLKGNKGEKGEDGFPGFKGDMGIKGDRGELGAAGPRGEDGPE
GPKGRLGPGEAGPLGPTGEKGKLGVPGLPGYPGRQGPKGSQGFQGFPGANGEKGTRGTAG
KPGPRGQRGPTGPRGERGPRGPTGKAGPKGNSGNDGPPGPPGERGLPGAHGPTGFPGPKG
PPGPPGKDGLPGHPGQRGETKTQGFQGKTGPPGPPGVVGPQGPTGETGPMGDRGHPGPPG
PPGEQGLPGAAGKEGAKGDPGPAGPAGKDGPPGPRGFTGERGLPGPVGAHGLKGNEGPHG
PPGPAGSPGERGPAGPAGPTGLPGRPGPQGPPGPAGEKGGPGEKGPQGPAGRDGIQGPVG
LPGPGGPPGPPGEDGDKGEIGEPGQKGSKGDKGEHVRSPGPTGPQGTVGAPGPAGGPPGP
VGLQGLPGPAGEKGETGDVGQMGPPGPPGPRGPAGPPGADGPQGPPGGIGNPGAVGEKGD
AGETGEPGPQGEVGPPGPRGERGEKGEAGPAGAAGPPGPKGPAGDDGPKGSPGPIGIPGD
PGPPGEPGPAGLDGPAGDKGDDGEAGQPGSPGPTGESGPSGPPGKRGPHGPAGPEGRQGE
KGAKGESGLEGPQGKTGPVGPQGSPGKPGPEGLRGIPGPVGEQGLPGSPGPDGPPGPMGP
SGLPGLKGDTGVKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPSGSAGPKGDTGIAGPSGP
LGPVGPPGLPGPPGPKGAKGSSGQTGPKGESGTPGPPGLPGPPGDIIHPHPIQSSMKGRT
RRNIDASQMDDAAADANYKDYDDGMEEIFGSLNSLKLEIEQMKHPLGTQSNPARTCKDLQ
LCHPDFPDGEYWIDPNQGCSRDSFKVYCNFTAGGESCIFPDKKSEGSRVTSWAKESPGSW
FSEFKRGKLINNLSYGDAEGNPIGVVQMTFLRLLSAAGRQNMTYNCYQSVAWHDQDGDNY
DKAIRFLGSNDEEMSYDNNPYIRALADGCALKKGYEKTVLEINTPKVEQVPFVDIMFNDF
GGSTQKFGFEVGPVCFIG
Download sequence
Identical sequences H3CKB6
ENSTNIP00000008695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]