SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008739 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008739
Domain Number 1 Region: 207-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000068
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 339-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000778
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 3 Region: 373-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000269
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008739
Domain Number - Region: 26-129
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000448
Family C-type lectin domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008739   Gene: ENSTNIG00000005999   Transcript: ENSTNIT00000008909
Sequence length 512
Comment pep:novel chromosome:TETRAODON8:Un_random:84476831:84478451:-1 gene:ENSTNIG00000005999 transcript:ENSTNIT00000008909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFSAKQLRVFALFLCGLQEAALSHGGLCTDTQCFGVFVKPTRYSDARRVCEDFSGRMFR
YNLTVLTDIFKSLPDGEFWLEQEEAAATPQNCSSVALTPERSFAHRRAPCHQTLSGFLCQ
YPLQDSCSQLEPAGASRVNYTAHMDFAVWNSQIFPMGTTAEAFAAGSQHLEWKRLCISGF
WLEAPWNCEVMKGGCEHGCNVTTASCTCPAGQSLHGNNLSCVEDPCARCAQECRREGDAR
VCGCKEGYRLGRDGRSCVDVDECEDGDPCTGEGEECVNVEGSFECHCEDGLEREEGACVN
RSICFKCEHMKCVKSSGVYECACQEGYRVRANDPTKCDRHCEESRCEPQCDPNSQGQMQC
FCPEGYILDQSNSSGVCIQIDECEHACEHTCVKTPGGFRCSCFEGFILHRDSRCLPVGRE
RARHRRVPGAVRRAAPLPHLQLGEAVPQVRPRDPQAPKHRHLPPAAGHHRDLQEVVLLMS
LFPTPTDTPGQPSGFKTMKYLSQKLGAVMVNV
Download sequence
Identical sequences Q4SWS1
99883.ENSTNIP00000008739 ENSTNIP00000008739 ENSTNIP00000008739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]