SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008750 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008750
Domain Number 1 Region: 204-341
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-37
Family Third domain of FERM 0.0035
Further Details:      
 
Domain Number 2 Region: 103-206
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-29
Family Second domain of FERM 0.0000764
Further Details:      
 
Domain Number 3 Region: 17-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-27
Family First domain of FERM 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008750   Gene: ENSTNIG00000006009   Transcript: ENSTNIT00000008920
Sequence length 594
Comment pep:known_by_projection chromosome:TETRAODON8:12:7672029:7702581:1 gene:ENSTNIG00000006009 transcript:ENSTNIT00000008920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRFRSPSSRSLDQEVLCTIRLLDDSEISCSIQRDTRGQFLLDHVCNHYNLLEKDYFGIR
YVDPEKQRHWLEPNKPVARQMKLAQQPFTMCFRVKFYPSEPMKIKEELTSRYLLYLQLKR
DIYHGRLLCPFAEAAYLGACIVQAELGDYDPEEHPSDYIRDFKLFPKQSLKLERKIIETH
KNELRGQCSALAELNMLQRAHSLETYGVDPHPCKDFTGSTAFLGFTAKGFVVFQGNKRIH
LLKWTDVSKLKFEGKTFYVIGIQKEKKLVLTFHTSTPAACKHLWKCGVENQAFYKCAKSS
QIKTVCSSNIFFKGSRFRYSGRVAKEVIEASSKIQREPPQVCTVQFGQSRSFNSLSHKNL
IMNMEPLVPALPSTNECEDAAGDNERDQPLAKHTRTSSALLSRSPISSSKIQREPPQEDG
DEASSPLTISELAYSPCASMLPTPISDSQRGVDLLFSSPVQSPARMLRELHADPEIQARL
EAEREQDRAYERTCQAARGHAGGLLSGSLRLLSSNERVNACLLSVARFVAVVMGILLVTV
PTLLLLLESDIDVSFLHEIRQTPEFEQFHYEYYCPLRRWILCKISLAMENLWSD
Download sequence
Identical sequences H3CKH1
ENSTNIP00000008750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]