SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008753 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008753
Domain Number 1 Region: 141-229
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000263
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 241-302
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000628
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008753   Gene: ENSTNIG00000006011   Transcript: ENSTNIT00000008923
Sequence length 360
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:84573213:84577162:-1 gene:ENSTNIG00000006011 transcript:ENSTNIT00000008923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRRPSNASEKEQVQKKKLSLQRSSSFKDFMKNKPTSPVSEKEITLEENVVLGGTEDSM
KSGIKLGKKWRNVISRTMTRKTSKMAQKALAEEGSDSGDELSPVSSDTPPDLSLGQRTSV
CSTGSEDTTSSPITRQLSGSSDRQSLDSGYSQRDSMRLEENSYSGPFCGRALVHTDFTPS
PYDVESLKLQKGDIIYIIEKPPAGTWTGKLNNKVGSFKFIYVNLLPDESPPARRRHRNSR
SCKDKSRPKTLEEVLDNIGLSELSSLLFMHGFQNLEDFDCKETHLNELNITDPEQRSKIL
NASVTPERLTVVESEPEEEGKDSNHPRDSGCFESSENLEAGREEGNKEEQLEEQSLAGNT
Download sequence
Identical sequences H3CKH4
ENSTNIP00000008753 ENSTNIP00000008753 99883.ENSTNIP00000008753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]