SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008766 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008766
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-31
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 125-298
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000019
Family Pentraxin (pentaxin) 0.006
Further Details:      
 
Domain Number 3 Region: 775-1075
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000375
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008766   Gene: ENSTNIG00000006023   Transcript: ENSTNIT00000008936
Sequence length 1176
Comment pep:known_by_projection chromosome:TETRAODON8:14:9567608:9582003:-1 gene:ENSTNIG00000006023 transcript:ENSTNIT00000008936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSCDLVLTEVQGSFTSPCYPQLYPNSQSCRWTMQAPAGFVIQLTFLDFNLEESSGCNYD
SVVVATGSGDIKFCGPTANGLTLNSTGNVMKLRFTSDFSVQKKGFAVSFKRVAVALRNQK
VLVTSGNSHVTELSDSVSMPTLSQFTLCLEVERLSDKQSTKGVFTYSDANDDVALSIGTD
GNGMQLVVDGVSCLLDPALAAADIALSMKMLCFTWASASGQVGVYSDSGYNAKACPVSAG
HTVASGGHFRLGGQHNFNGHVYNLRLWDFAMTTQQLQALSCDQVGNVVDWDNSYWNIPSS
LAQTDTALSCSVSVSTNPPVPTSCDPPGPGCPEGLFYRVSFAVEDVAAALSRAEVEEAVA
SWLNQTFQNWTHAVAMDHISVITVCLGLLRVQPVPQSPTRYGCQALLVYYHATNQSLSAA
AVSARLSASEAQVGSGLQVQPADVTPIGNCPEENPLHYRWPESRPTATQILPCFPNKDQS
TSRTCWLDPDSLAASWSPADLGNCTANAAEVADQLSDITSNELTNQEVSQVVMKVKQLVG
VANISGALASTVVTILSNVLSSSETALAPTSETALKTVDELVQKLEFQGPSISITSRHLA
VGVSSFSAATFNGTSFSAFLEPNTSEPQVAIHFEDRRDPLAQVTLPASLLSGAALTEAEL
SSTSRINFMFFSSTNLFQRQQAGRALVSYVVASSVGNLSIRDLMEPVRIQIAHLSEQEVL
SPVCVFWDFSMSGGAGGWNGSGCRVSAESTSSRTVCLCDHLTHFGILLVRPWTSTACPRT
STPQNNQILTFITYVGCGISSVFSAATLLTYIAFEKLRRDYPSKILMNLSTSLLFLNMVF
LLDGWLASLHIRWLCLGVAALLHYFLLTSFTWMGLESIHMYIALVKVFNTYIRRYILKFC
IVGWGLPALLVGIVVASDKDSYGPKENDTAPSAASEFCWIKAPLVFYTTCVGYFCLVFLL
NVAMFVVVMLQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMTWGFALFAWGPVSLAF
MYLFSIFNSLQGLFIFIFHCALKENVQKQWRRYLCCGRFRLSENSDWSKTATNNTKKVSS
EHLGKSVSSSSCGSGATSWTSKAKAGLNPFSKRHSSADKRFSSQTNPKSSSASSSEVQIL
PVSQMIDKVKDYCSTRSDNFYKNILMSDSFTHSTKF
Download sequence
Identical sequences H3CKI7
ENSTNIP00000008766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]