SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008767 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008767
Domain Number 1 Region: 387-541
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-61
Family Ankyrin repeat 0.000000447
Further Details:      
 
Domain Number 2 Region: 265-383
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.89e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00000208
Further Details:      
 
Domain Number 3 Region: 2-113,149-174
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-29
Family BAR domain 0.0042
Further Details:      
 
Domain Number 4 Region: 154-246
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-18
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 5 Region: 725-784
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008767   Gene: ENSTNIG00000006024   Transcript: ENSTNIT00000008937
Sequence length 785
Comment pep:known_by_projection chromosome:TETRAODON8:14:9585371:9592825:1 gene:ENSTNIG00000006024 transcript:ENSTNIT00000008937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKIEKEKKEHARQHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLL
QNLIKYFHAQCNFFQDGLKAVDNLKPSIEKLATDLHTIKQVQDEERKQLTQLRDVLKSAL
QVEQKESRRDSQVRPSTTYSLHQPQGNKEHGTERSAYLYKKSDGLRKVWQKRKCTAKNGY
LTISHGTANRPPKLNLLTCQVKHNPDEKRTFDLISHDRTYHFQAEDDQDCQIWISVLQNS
KEEALNQAFKGDQHVGENNIVQELTKAILVEVKRMTGNDVCCDCGAPNPTWLSTNLGILT
CIECSGIHRELGVHYSRIQSLTLDVLSTSELLLAKNVGNAGFNEIMEACLSAENVVKPNP
ASDMQVRKDFITAKYTEKRFARKKCPDTTSRLHTLCDAVKARDIFSLIQVYAEGVDLMEP
IPLANGHELGETALHLAVRLVDRTSLHIVDFLTQNSLNLDKQTVKGSTALHYCCLTDNSE
CLKLLAAGKSLHRHRSELMRAGETPLDIARRLKHVQCEELLNQALAGKFNAHVHVEYEWC
LQHEDLDESDEDLDEKLQPSPLRRDERPVSCYTPSNNASLGSAGLMKDKQRAFLPSLVNN
ETTAPSNPGRPPRSASRAEEESVAPPLHPPTVTSNHTRTETTGPWSTSWKSGTLDAVGRQ
RSSSDPPNMHPTVPPMRLVSAGVSSPLSFPPPVPAKEVPGCPQNSGGQSLPPAPLLRKTF
HKQRPKRVKAVYNCVADNPDELTFAEGEVIVVDGEEDQEWWLGHIEGEPMRRGAFPVTFV
HFISD
Download sequence
Identical sequences H3CKI8
99883.ENSTNIP00000008767 ENSTNIP00000008767 ENSTNIP00000008767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]