SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008802 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008802
Domain Number 1 Region: 275-547
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-73
Family Eukaryotic proteases 0.0000959
Further Details:      
 
Domain Number 2 Region: 159-267
Classification Level Classification E-value
Superfamily Kringle-like 1.62e-30
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 55-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000479
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008802
Domain Number - Region: 93-132
Classification Level Classification E-value
Superfamily FnI-like domain 0.00022
Family Fibronectin type I module 0.0037
Further Details:      
 
Domain Number - Region: 2-25
Classification Level Classification E-value
Superfamily Kringle-like 0.00722
Family Fibronectin type II module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008802   Gene: ENSTNIG00000006059   Transcript: ENSTNIT00000008972
Sequence length 554
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:84843072:84847332:1 gene:ENSTNIG00000006059 transcript:ENSTNIT00000008972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTSGHECKFPFRQGGRIHHHCITFLSSRPCNANSPAPGDARASAWFCFSSSPSPDPCKVN
PCQNGGVCALVPRTDGFRCSCGKSFTGALCELRRCYETSHLRYFDAGESWGRIHLRNVEQ
CTCAAGQVSCEKVRYTACRSNPCHNDGTCRLISSTGREVCSCRHGYGGAHCGVDLDSECY
NSKGADYRGAAGTTLSGGQCLPWNSDLLYDELHVGTVEASSLRGLGGHAFCRNPDGDAMP
WCYTLSDGAISWEYCRLPSCAMAVSSSRRLNPFHAAAVAKMPAPNRRSKQPVCGRRHQKR
LAMARGRILGGNSALPGSHPWMAAIYVGQQDFCAGTLVSSCWVVSAAHCFFRSPLLSQIR
VVLGQQRFNVTDHNSKTFGVEKYVLPEQFSVFNPTLHDIVLIKLKKQDGRCARRTPFISP
ICLPDKNTTFPDHFCCTISGWGHMHERGSTRVLAACEEAGVRLVPHHVCRRAEVYGNHVT
DGMLCAGLGGCADACQGDSGGPLACARDGVSFLYGVISWGEGCGRSGKPGVYTNVLKYID
WIHSVLKRKSGKAS
Download sequence
Identical sequences H3CKM3
ENSTNIP00000008802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]