SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008895 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008895
Domain Number 1 Region: 5-252
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.04e-79
Family Calponin-homology domain, CH-domain 0.0000842
Further Details:      
 
Domain Number 2 Region: 1318-1429
Classification Level Classification E-value
Superfamily E set domains 3.02e-34
Family Filamin repeat (rod domain) 0.0000257
Further Details:      
 
Domain Number 3 Region: 1411-1527
Classification Level Classification E-value
Superfamily E set domains 1.27e-31
Family Filamin repeat (rod domain) 0.0000407
Further Details:      
 
Domain Number 4 Region: 1518-1626
Classification Level Classification E-value
Superfamily E set domains 2.67e-31
Family Filamin repeat (rod domain) 0.00000415
Further Details:      
 
Domain Number 5 Region: 1051-1141
Classification Level Classification E-value
Superfamily E set domains 4.8e-29
Family Filamin repeat (rod domain) 0.0000103
Further Details:      
 
Domain Number 6 Region: 548-652
Classification Level Classification E-value
Superfamily E set domains 5.6e-29
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 7 Region: 2033-2126
Classification Level Classification E-value
Superfamily E set domains 1.11e-28
Family Filamin repeat (rod domain) 0.0000218
Further Details:      
 
Domain Number 8 Region: 1848-1942
Classification Level Classification E-value
Superfamily E set domains 1.6e-28
Family Filamin repeat (rod domain) 0.00000829
Further Details:      
 
Domain Number 9 Region: 1144-1252
Classification Level Classification E-value
Superfamily E set domains 2.01e-28
Family Filamin repeat (rod domain) 0.0000464
Further Details:      
 
Domain Number 10 Region: 836-955
Classification Level Classification E-value
Superfamily E set domains 3.87e-28
Family Filamin repeat (rod domain) 0.00089
Further Details:      
 
Domain Number 11 Region: 742-856
Classification Level Classification E-value
Superfamily E set domains 6.41e-27
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 12 Region: 658-766
Classification Level Classification E-value
Superfamily E set domains 2.27e-26
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 13 Region: 2225-2315
Classification Level Classification E-value
Superfamily E set domains 2.27e-25
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 14 Region: 440-546
Classification Level Classification E-value
Superfamily E set domains 3.07e-25
Family Filamin repeat (rod domain) 0.0022
Further Details:      
 
Domain Number 15 Region: 1615-1728
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.000063
Further Details:      
 
Domain Number 16 Region: 2546-2636
Classification Level Classification E-value
Superfamily E set domains 2.07e-24
Family Filamin repeat (rod domain) 0.0000103
Further Details:      
 
Domain Number 17 Region: 2416-2508
Classification Level Classification E-value
Superfamily E set domains 5.54e-24
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 18 Region: 262-359
Classification Level Classification E-value
Superfamily E set domains 1.2e-23
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 19 Region: 362-462
Classification Level Classification E-value
Superfamily E set domains 2.2e-23
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 20 Region: 1244-1341
Classification Level Classification E-value
Superfamily E set domains 2.5e-22
Family Filamin repeat (rod domain) 0.0000458
Further Details:      
 
Domain Number 21 Region: 938-1045
Classification Level Classification E-value
Superfamily E set domains 4.27e-22
Family Filamin repeat (rod domain) 0.0031
Further Details:      
 
Domain Number 22 Region: 2144-2239
Classification Level Classification E-value
Superfamily E set domains 1.47e-19
Family Filamin repeat (rod domain) 0.0000677
Further Details:      
 
Domain Number 23 Region: 2324-2412
Classification Level Classification E-value
Superfamily E set domains 1.47e-19
Family Filamin repeat (rod domain) 0.0000277
Further Details:      
 
Domain Number 24 Region: 1953-2045
Classification Level Classification E-value
Superfamily E set domains 1.87e-16
Family Filamin repeat (rod domain) 0.0000998
Further Details:      
 
Domain Number 25 Region: 1786-1865
Classification Level Classification E-value
Superfamily E set domains 4.54e-16
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008895   Gene: ENSTNIG00000006148   Transcript: ENSTNIT00000009066
Sequence length 2637
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:85329068:85349363:-1 gene:ENSTNIG00000006148 transcript:ENSTNIT00000009066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEEEEEEEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIADLQKDLSDGLRLI
GLLEVLSQKKMFRKFHCRPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIVDGNLKLIL
GLIWTLILHFSISMPMWGDEDDEDAKKLTPKQRLLGWIQNKVPQLPITNFHRDWRDGKAL
GALVDNCAPGLCPDWETWDPSQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVM
TYLSQFPKAKLKPGAPLRAKTLHPRRAKAYGPGVESRGNVVLKPAEFLVETVEAGLGEVL
VYVEDPEGHTEEARVTPNNDKNRTYSVVYLPKVEGFHQVKVLFAGQDIDRSPFRVNVSKA
MGDPTRVQARGPGLQQTGNVAGKPTYFDIYTAGAGAGDVGVILVDSNGRRDTVEIVLENR
GDSVFRCTYIPVLEGLHMVHVTFAGQQIPRSPFAAHISEACNPNACRASGRGLQPKGVRV
KEVADFKVYAKGSGSGELKVVVKGPRGAVEPVKVVEMGNDMFECSYYPVSRGKYVVTISW
GGHNIPRRHSPFEVHVGEEAGPQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIE
GPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHVLSAANDTFPEN
VKCSGPGLEPLGCIINKPAEFTMDTRGAGRGELKLYAQDAEGFPINIQMTENENRTFFCV
YVPTKAIKHTIIITWAGVTVPNSPFRVMVGEGSHPENVKVYGPGVERLGLKANEPTYFTV
DCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGSGQYTIMVLFAD
QQIPISPFRIKVEPSHDAAKVRAEGPGLNKTGVEVNKPTHFTVYTKGAGKAQPEVHFTAA
GKGSVVQDFEIIDNHNYSYTVRYTAVQQGNMSIAVCHGGDPIPKSPFHIMVAPLLDLSKV
SVQGLNSKADVGKDEDFTVRTQGAGGQGRLDVKILSPSRRPIPCKLESGVNNEVYTVTYI
PPEEGAYRVDISYDGNPVPGSPFAVEGVLPPDALKVRAYGPGLQGGLVGKPAPFAIDTKG
AGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYAINILFAEQHVPGSPFKAVV
QSLFDPSMVTVSGPGLERGKVNEDGSFTVDCSKAGDAELTIEIVSESGAKAEVHVQNNRD
GTYSITYIPLFQGLYTITIKYGGCAVPNFPSRLLVDPAVDTTGVKVYGPGVEPRGVLREV
TTHFIVDAQCFYMGGGDHIKACVSNPSGATTDAYITDKGDGTYRVEYTPHEDGLHLIEVL
FDEVLLPKSPFRVLVTEGCDPSRVRAYGPGLEEGLVNATNCFTVETRGAGTGGLGLAIEG
PSEAKMSCKDNKDGSCTVEYIPFNSGEYDVNITFGGLPIPGSPFSVPVRELVDPSKVRCF
GPGLEIGVRAHVPQTFTVDSSKAGLAPLVVQLYGPTGVAEPITVTDNNDGTHTANYSPAN
DGPYTVCVKYADQEVPCSPFKIKTLPAHDASKVRASGPGLNASGITASLPVEFTIDARDA
GEGLLTVQILDPEGKPKRANIRDNWNGTYTVSYVPDMTGRYTITIKYGGDEIPYSPYCIH
AIPTGDASKCLVTVSIGGHGPGSGIGPTIQIGEETVITVDAKAAGKGKVTCKVTTPDGAE
LDVDVVENADGTFDVYYTAPEPGKYVITIRFGGENIPNSPFHVVVEKGIRFFLKFLMLDV
LLNGERVEMLAKEVMWSPELATSDPVSPINGMEAMLRPFSLVIPFTVQKGQITGEVQMPS
GRTACPYITDNKDGTVTVKYSPTERGLHEMEIKYDGSHIPGSPLQFYVDAINSGHVTAYG
PGLTHGTVNTPATFTIVTKDTGEGGLSLAVEGPSKAEIACKDNKDGTCTVSYLPTACGDY
NIVVKFDDKQIPGSPFTAKITGDDFTRTSQLNVGTASDVSLKIMETDLKSLMASIRAPSG
NEEPCVLKRLPNRHIGISFTPKEVGEHVVSVKKTGKHVSNSPFRIMVGQSEIGDASKVKV
FGQGLIEGHTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPG
NYIINIKFADQHVPGSPFTVKVFGEGRVKESITRRRQAPSIASVGSTCDLNLKIPGEAGM
QEMVAQVTSPGGKTEDAEIIKGEDSTFSVRFVPQEMGAHTVNVRYRDQHVPGSPFQFTVG
PLGEGGAHKVRAGGTGLDRGVAGVPGEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDG
SCGVSYVVQGPGDYEISIKFNDEHIPDSPFTVPISTLSDDARRLTITSLQEMSLKVGHEA
SFAVQLNGARGLIDAKTQSPSGATEECSITELDADQHAIRFIPRENGLHTIDVRFNGSHI
PGSPFKIRVGELGQNGDPGLVSAFGSGLERGTTGLASDFMVNTCNAGSGALSVTIDGPSK
VKMDFQECPEGYKVSYTPTAPGNYLISIKYGGPQHIVGSPFKAKVTGPHLSSGHGLRETS
SVLVETVSKSTAKGAAFASFPKFSSDASQVLLRGAGLSKAFISQKNSFTVDCSQAGTNML
MVGVHGPERPCEEVYVKHMGNRMYNVTYTVKEQGSYILIVKWGDDNVPGSPFHVTVP
Download sequence
Identical sequences H3CKW6
ENSTNIP00000008895 ENSTNIP00000008895 99883.ENSTNIP00000008895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]