SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008912 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008912
Domain Number 1 Region: 56-516
Classification Level Classification E-value
Superfamily Sema domain 3.01e-143
Family Sema domain 0.00000017
Further Details:      
 
Domain Number 2 Region: 512-554
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000113
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008912   Gene: ENSTNIG00000006164   Transcript: ENSTNIT00000009083
Sequence length 984
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:34145401:34158759:-1 gene:ENSTNIG00000006164 transcript:ENSTNIT00000009083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALALALAAVLPLLSSGAAPFPQDLEPLSRVGRETSHLYPSFQGLLSDNDTVRLGLDFQR
MLRINHVLYIAARDHVFAVNLDASSEQIVPQQKLTWKTKDVAKCTVRGKNSDECYNYIKV
LVPRNDETLFACGTNAFNPTCRNYKMATLEQDGEEVVGQARCPFESHQSNVGLFAGGDFY
SATMTDFLASDAVIYRSLGESSPVLRTVKYDSKWLREPHFLHAIDYGNYVYFFFSEIAVE
YTALGKVVFSRVARVCKNDNGGSPRVLERYWTSFLKARLNCSVPGDSFFYFDVLQSLTNV
LQINRRPAVLGVFTTQANSITGSAVCAFYMDDVEKAFSGKFKEQRNSESVWTPVPDEQVP
KPSRPGCCAGEGSAAAYKSSTAFPDETLTFIKTFPLMDESVPSVDDRPLFTRTTSRFKLS
QVAVDTSAGPSKNHTVVFLGSDNGHVLKVLASTQGPNATFSTQLLEDLDVYNPSRCGVRG
DDRRVLGLELDRDHHALFVAFSSCVIRVPLSRCSDYSTCRKGCLSSRDPYCVWLKSGSCV
SVSPGFRGVFEQDVEAGFHQNFPDVCHDVLATTRRQNTALDSAYATTTGVRRPPELDRTN
HSVHYTLLIACVLVAFVLGAFLSAFLVSCYCNRAGRRSRKLAKDPEAPIPHALSLRSLAR
LNGLLDSKDQKLDVSTPQIYNSFFSSKEQLGSRRSQHHQHHHLHPPSELSGLPTPDSTPE
LPIKSMKAFRNQWEKNQNCNNAKEPRSLGPAAPAVFPYPHGLSGGPLQADERKIHNVDRL
LTQPAYPDPCQKVMEVTSLDELLKHIHAGAGSKTPQLMSPSGLYAGGGAQLAFSNRIQPQ
IPETESAPYYSSSTLPRDSLTRRLDVPPDMPPHHQSTLERRQRHSLMTAMPRQHSFSQRN
AVPHQPPPLLSRMNSAGSACEVHRPLIPNGFLTRQQSFGGGEQQEVPHRGALLRRTPSLK
PDVPPKPLFIPATSPVNQQGKFNY
Download sequence
Identical sequences H3CKY3
ENSTNIP00000008912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]