SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008970 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008970
Domain Number 1 Region: 1028-1269
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-40
Family Extended AAA-ATPase domain 0.0085
Further Details:      
 
Domain Number 2 Region: 1719-1968
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-39
Family Extended AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 3 Region: 1337-1598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-34
Family Extended AAA-ATPase domain 0.039
Further Details:      
 
Domain Number 4 Region: 641-701,798-960
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.16e-33
Family Shikimate kinase (AroK) 0.07
Further Details:      
 
Domain Number 5 Region: 5303-5510
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000556
Family Integrin A (or I) domain 0.048
Further Details:      
 
Domain Number 6 Region: 287-553
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000262
Family ABC transporter ATPase domain-like 0.07
Further Details:      
 
Domain Number 7 Region: 2032-2091,2226-2295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000161
Family ABC transporter ATPase domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008970   Gene: ENSTNIG00000006221   Transcript: ENSTNIT00000009141
Sequence length 5518
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:25585195:25663035:-1 gene:ENSTNIG00000006221 transcript:ENSTNIT00000009141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLDLSLSSLGNISKHVEKSHNELAQYLSKQVWSQQDRQSLLDCLAQLLLEKDHTLLIA
RHLRPFILDLLERNAERVRAGGRINHDLHERLCVALSKLLNISPDAKMFAARYFSQSPPV
FQRLFFTTEESSAVQYGPRRMKLRDLMAATLRFLQNDCAAYRVLWDWSPCVSQLLTSDIM
VRGYTAHCLALVSHMTDNQKSIFLRKVLTSDEILHMKMTALEETQQLEVEKALVLTNQGR
VMSQEKTEKFTRGQVTSADLSQSVVAVCSVLLPRVVPTQAEQQINPKDLVLVDSTCHSLK
RLALALASQKPVLLEGPIGCGKTSLVEFLAGATGHAQAREILKVQLGDQTDSKKAEVDKL
RPGTTCGPMNYLIQPGVDRIFFYLGWVEKSEANKAKINVQSSMVNALVEFKQIPLSSRSS
TMAVFPDCRMYYSSGAWNRPQNSHAALLDKYWIKLQMRTMTREELKKVLINKYSQLTMVL
DRLLDIYCQLTGQQHSDVDTTDLQTHDGNQVNKTEDRSMSMEGRSLSLRDLLKWCDRISV
NFDGTSSATAQHVFLEALDCFTAMLARPESRLQMAEAIGSKLNISKEQAQHFCQMYQPGI
TKSESEVSVGRITLRRKQNESVHLSVDSQTFAATRPSAVLLEQLAVCVSRGEPVLLVGET
GTGKTSTVQYLAKLTGHRLRVVNMNQQSDTADLLGGYKPVDQKQILLPLLEAFEELFSQT
YSRKQNLTFLGHVQTCFRGKRWHDLLKLMDHVCKSALTKELQEKTNGIVLNQERWEMLLV
KLRQTQQQIRACETAMVFAFVEGTLVQAVKKGNWILLDEINLAAAETLECLSGLLEGSAG
SLVLLDRGDTEPLVRHPDFRLFACMNPATDVGKKNLPLGLRNRFTELYVDELEKEGDLRI
LVSDYLKGLTLQRSVISGIISFYLAVRKQADAHLVDGTGHRPHYSLRTLCRALQYVGSNP
CKSVQRSLYEGFCMSFLTQLDRSSHPVVQKLVCQHILLGNTKCLKQPIPAPSSHACVEVQ
GYWVARGEMEPVLDPSYVLTASVKLNLRDLARVVSAGSHPVLIQGETSVGKTSLIQWLAS
ATGNHCVRINNHEHTDIQEYIGCYSSDNRGKLIFKEGSILINAMRKGYWIILDELNLAPT
DVLEALNRLLDDNRELFVAETQEVIKAHPGFMLFATQNPPGLYGGRKVLSRAFRNRFVEL
HFDELPSKELETIIHQRCSLLLSFCTKLVQRYMTGQLQAFRRGSSVFAGKHGFITLRDLF
RWADRYRLEDQEKASQDWLQHFDNSKRKINTEELFSQQHVVSQFSKFFSYLFNVVRMAGT
SIDSIAGVPEEFRHVVWTYGMRRLAVLAGRALRFGESVLLVGDTGCGKTTICQMFAALAG
HKCYSVNCHLHLETSDFLGGLRPIRHTGQTDDEDGRLFHWHDGPLVLAMKEGGVFLMDEI
SLADDSVLERLNSVLETQKSLVLVEKGSGDKEDVELISAASTFRLMATMNPGGDFGKKEL
SPALRNRFTEIWCPQANSRWDLVQIIQHNLRSGLILDGNETRRGDIAELILDFIEWLTHQ
DFGRHCILSVRDILSWVNFLNTVCERDEDGFMTMGVLEDDEESEWDLKLDTVTAFIHAAC
LVYIDGIGSGPTVSCADGAFRARRLCLEFLQQRLSKMTRLDQETLEALRVYDCSLLREPQ
WGEDFFGIDPFYIALGPQAESQNLSDYAIAAGTTAMNAQRLLRALKLQRPVLLEGSPGVG
KTSLVAALAKASGNPLVRINLSEQTDITDLFGTDLPVEGGKGGEFAWRDGPLLAALKAGH
WVVLDELNLASQSVLEGLNACFDHRAEVYIPELGMSFQVQHEKTKIFACQNPFTQGGGRK
GLPKSFLNRFTQVFVDQLTGTDIEFIGDSMFPRIDKEIISKMVAFNNTLVQEVCVERRWG
QKGSPWEFNLRDMFRWCELMQADQSPGFYNPGQHVALVYSDRMRTETDKAQVLSVFRKVF
GEDFEPYNGSRQFHITPLNLQVGFSVLPRSGGAPVALDPPLSITHQALHPLESLMKCVER
GWMTILVGPTASGKTSLVRLLALLTGHRLRVMAMNSSMDTTELLGGFEQVDIMRPWQQVL
ESVDYIVAMVIRRGLMSLEIGIQDTEFLLQTWGLFCHWLKEEGLQRSGGSVSAEALNKLE
VIILLLQKLNTKLKSCICPLDMSKLQMDFTSDGGRGDSGSKAKYHGTAVDAYKWFQEEKK
SQLILKLCNASVLDRLNALLEPGGSLTINERGVIDGKTPQIVPHPNFRLFLTMDEAHGEL
SRAMRNRGVEVYIPGEREDVSWDAIDLKTLLHTAGVVGDCVCDLLIEIHKSIKSTIWDSP
ASSVVSLLNAATLLSCQLQRGVDLPSALQHACGDTYSMCQRSTAKQKQAQQIIEQHLAVL
DADDWGNGLLCAGVWPDGFPSALLSTEDSCFSSVLRDGQVLSFCLNTLSLQGKRNRPLSL
GDLKKVLQSGGLQEGQVFPGGMVDLEEGDALQLIPTAVRLLTERASHGDWNLRSSWLLHL
GKSYQHIPDSILVQMEAGNRALNAVFGSKLAAKGKSLAELLQPHSVDEYRILVDMRWNKQ
YLDILASKCNFEDEERYMDFLEALNTVANRIVLMTDREERSVICTYSTNLSSQNSALGIA
TAFSKGFVDVGHLPHPVLIHLRSFFDLWESFTLQALQNGQPFISDHITFEILQLLQWLDH
FWDACNTLPADSQNISTLSLHWQWVQKHLITRLPQLLLGDSEPLLEEHQELQAVSAAIQT
LLSTPVCVAAALKGIQKTLGKALPFKLMAVADCASRLKRLSKALDLNDLGLDNPAGSVRQ
KLARLYVVGLELDIKESLLEACGLVLLANSHLNPHPSGVLDRLMSSVEQQQREMTFRGLL
DVCSHSEYEEPEGRLELSTQELQQLSHRVQLWPLMEKLAVLNQLRLSNDLLHLAFAPGDQ
KTEESLRRELSRHLRYCLQSTPINLSHLQPLWFLLSSEKEFVPPQPADELQFVWCELLSQ
ALAAIWSSSVTADPNLWLKWDPQRLKDQPVSKKNLGIDIRGPAVLSKAVWSHCVLGVLSS
SDSVAPWAPSGEALLSHSYITLGKCKDRIQQLQDLSAVLWDNMGMPTLAEFRGTDFRLQG
TVLRRQLQSMADLLPPSLQEGYMESCESLVEDPDPLIAAQEIQTVLREFLPPNILPEGLI
EICMTCLEQYVRNKVQSSDQLACSGVFWVNLGLLQIKVWTPQAIFDPAVKRSYKLIYAQQ
ELSLLQEEWRSRSLSSQMMTGAELTESSITDGFQHPRIRYLWIRMQQLKEQIAELSRKQA
CRPNESHYGQLFQELQHYLCSIGQKSSVDHLLSRLLNALQGSSTAKSRSMVQGLLKEVAV
WQKSQQHFCQKLVDDFPLYPDVVGPIQTGILQLRHGMSLVASQLATSLTPLPGLLKLVSC
LLAFPTLSHSFPSHLARADFLFSSACTDILHCLVKLLPQPDCGRVVPQTSLLRLNALLYV
QCHALCTGEFNQETFSLFSHICQALVKEWDEQEQRKREQEQIDASLYRSRSRHHGSCLTE
EEQEERAFRHCFPLFNQDFADLAPQPCLECPSGSSLEGEEKNLEEGSSQSGVLSPEAINT
LVEVHQHLCLGYARSLWYQSTAPTTNGKEHIAALLSSCQIASPLMSRFYHLIDAELDQML
TGSELLLSTLLQNTVQGPGTPGNLAISSEGPYDFYHQPNMKEARLCFSVLEQLNVAVNQR
LQDWPEHLLVHQLTVIIERIMAFSLASPLAKFLNGLEILLSKAQDWENNASRSVSLGKEL
EQVTQFIVQWRKLELNCWSSSLDNVMRQHAKKSTRHWFSIYQLIGRYLEERTSSSKTEEE
PLSLSSVSSSLQAFIESSTLGEFHTRLALLLSFHCHLLMVPNQPGQEPLSSLLWNLHKYY
SQFSDCIQTTICQLRQPIEKELKDFVKISRWNDVSFWSIKQSVEKAHRTIFKFLKKFEEA
LSGPCLPALIEPESRSNNFDLDSLDQNSAENPIQQFFRTLKGSLPGQDVVNNSNLDEGFE
VSSLQGRLPSLTKKMKKLCVQLHKINQAPELTEDLDYFTGEIISNLHDLQSLTVDASAEK
EKQRADMKHILQQKQRALSELFKMLTEIGLSYRKGLIWNRTFNPEKSLCVQPDLDRLNFI
DSLKNTVSCSDRVFPEMLKAWDGCQKYFYRSWSRRIALQSALQHASKELGLGTVERCRGF
SSHLFKLLLKQRRSLAKLIHQWVHLRRQTNTIQSLKAQLQRNTEDPGCSLPPQQLLQNWL
SRGRTLAVQCTTVLQQLTTLLQCCPVDPQQKEETGSSRHHSLSCLSPLTAQRQPPGCLIR
KGDAAWHKLNQHVNAVLKDSESVKTELGSVAQQTLEEELLTWNHFATCCTSFDQLAAVGA
QMPSIEQLFTPPVGASNMNNQPAITQGLQYVRGQVEAGISAFTKWKAQVLALRQPHTDSS
EERPAFCSELSAQLDVIINTVLCAVQALMKKVEQKQVNTLQGDTVKNEAYYHKKLHQHKC
KLLRQNLAAEVEALCVGDVVGGLQRLLIHLRSLCDSGQPLQLQVVVMACRMLVHLEALLG
IYSDLVRYYVAVSIGAHRSTGKLLSVLASVFTQLAQKGFCLPQEMMAGGDGDGSMNFHDY
EGGGIGEGEGTKDISDKIENEDQVEDTFQEGEQKEEQKEEKIKSEDNAIEMSEDFDGQTY
DMDENEADKDNDTSEDEEEEQELDKKMGDLGEGHTDTLDEKMWGDDEDNDDKEEEFKKEE
KSGRGMDQTKSELAAKDDDLETADPSKDKGDETDSQTEEKINEQGDQRDFDENEVDPYHG
QQDTRPEPEAMDLPEELNLDQEEAHDDGPDEDRVEENPFDIGEKTSAVDEEDKQNDGEGE
EETAEEMEEIQTSHPEEESAQEPQDEEEKNVGDDKNNNPVEENEEEANKDEKGKEAVNGD
PRVPVDEEQRPKEGADVEEELPESSEREEHGASGQTSEQNIQSDTAVELAGEVSEKDQAK
EEHGNGAADANQSEGHESKLTARLTSQTQVEKKTQNFKRKPGHADNQHSAGDYNEQIKKR
LRTVERKEELAPDNRQSDVKQESELYQHVMQEETAYDTQTYGNVVNKNQHEAAGSQKDQD
DGKTNEETAMEMENQEEDLEAVEAQELKPEQLDSKNISHKDSSDMEFQCQEENMKEDNWK
EGEKSGEPRAEKAERSRESTYHTDPDLLLADTVQCVTEIDLEQARKEMELQLEAWHELSP
GSKEEMSAAFSMWHQYQHLTSTLSQQLCEQLRLILEPTLAAKLKGDYRTGKRLNMRKVIP
YIASQFRKDKIWLRRTKPSKRDYQICLAIDDSSSMVDNHSKQLAFESLSVIVNALTLLEV
GQVSVYSFGEHVQLLHPFHQQFNDESGARILRLCQFQQKKTRIAQFLETSTKMFLAAQQH
TPGSVNRASTETAQLLLIVSDGRGMFVEGKDRVTAAVRAALTTNVFIIFVVLDSPNSRDS
VLDIKVPIFKSPGEMPEIRSYMDEFPFPFYVILRDINALPETLSDALRQWFELVTATD
Download sequence
Identical sequences H3CL41
ENSTNIP00000008970 99883.ENSTNIP00000008970 ENSTNIP00000008970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]