SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009011 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009011
Domain Number 1 Region: 180-312
Classification Level Classification E-value
Superfamily Cadherin-like 7e-25
Family Cadherin 0.00048
Further Details:      
 
Domain Number 2 Region: 401-525
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-20
Family Cadherin 0.0027
Further Details:      
 
Domain Number 3 Region: 292-405
Classification Level Classification E-value
Superfamily Cadherin-like 5e-16
Family Cadherin 0.00082
Further Details:      
 
Domain Number 4 Region: 93-192
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000327
Family Cadherin 0.0021
Further Details:      
 
Domain Number 5 Region: 512-611
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000597
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 10-103
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000141
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009011   Gene: ENSTNIG00000006258   Transcript: ENSTNIT00000009182
Sequence length 839
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:85863153:85869213:-1 gene:ENSTNIG00000006258 transcript:ENSTNIT00000009182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDVSECLRKSATLTLTDPNFTISGAGRVEAAAPVAVPPAGRTFSVRALDGRGASSQMAVQ
LLHTPQRLGTQHKGQVLLRRFKRAWRPPPMNILENDVPPFPKFVETLESDSAAKRNVYYT
ITGPGLDQNPLNIFQFDFETRRLYVLGPIDRETYPSFMLTVRVFDQNTKVETDDPLLYSI
IIDDVNDNAPRFTGSLQVNVPENSKTGTEVGKLNATDDDQPGTDHVKIRYRLLDNLDKFS
IHPNTGVISTVTNSLDRETQDKYLVTVKIQDLDGKSAGLASTGTATIIVTDVNDNPPTFT
KLSYKVSIKENENDKLILRIPVEDKDLINTPNWVPKFVITKGNENGNFRIETDPKTNEGL
LHVSKALDYEKSQTVKLEIMARNEPELSGTSESWKSIPVDVTVIDVDEGPEFTAPNITFN
IKENTPNGTLIGRYTAVDPETKTSTGITYYKVKEPASWVNVDRQSGDLKVANTIDRESKF
VMDGKYIMTMKAVDAAFKTGMGTVILVIEDVNDNKPTLPTDELLICEKEGQHGSTVVVAE
DKDAEPFSFPFSFSLPPANDGKWALETINDTAALLKPIKDLPRRLYKVDIDVKDLQGNGD
IQTVSVRICQCINGVCMATDRLASMGSLAWLAMLLPLLLLLLLCLLLAFICVTKKEKMEL
EDAGDNGGILLTSNTEAPGEEVDSNLINIPPFGTKSENKGQQKCGNTGTWASGGQGSFNQ
APIKNGRYTSDLQEYYFNQDNLDSIDSRFLAQNSSFLHTWQTNGRYLEQKLPFLATVGDE
RYAEDIAHDYRFEGAGSVAGSIGCCSGYGDNNDLGFLNTLGPKFKTLADVCTTTSTTKR
Download sequence
Identical sequences H3CL82
99883.ENSTNIP00000009011 ENSTNIP00000009011 ENSTNIP00000009011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]