SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009015 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000009015
Domain Number - Region: 82-122
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00484
Family Moesin tail domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009015   Gene: ENSTNIG00000006262   Transcript: ENSTNIT00000009186
Sequence length 201
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:85929004:85930500:-1 gene:ENSTNIG00000006262 transcript:ENSTNIT00000009186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSIMAQGHKFQDLEEAGEVLVAFINSSQPEKLRQVKKEHQALFESHMETKTFVTQILKDL
ALSEENAGQRLDMENHKKQRALEHDKVEKQLRQYTAKNQIMDSELQFLQGELENLRSAEH
ELQILQNEVDEDTTEVIPSAVYVAQLFYLITRIKWEYDTQPNILKGVHYGADLATPINID
TSLQAQSDISDELWDFVSTKW
Download sequence
Identical sequences H3CL86
ENSTNIP00000009015 ENSTNIP00000009015 99883.ENSTNIP00000009015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]