SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009026 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009026
Domain Number 1 Region: 225-348
Classification Level Classification E-value
Superfamily Cadherin-like 6e-31
Family Cadherin 0.00061
Further Details:      
 
Domain Number 2 Region: 438-559
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 339-442
Classification Level Classification E-value
Superfamily Cadherin-like 4e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 122-229
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 553-660
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-17
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 24-102
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000942
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009026   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000009197
Sequence length 943
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:24010:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000009197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIRWNNDLLSWMLIVFLSDWTAAQTSFSVSEEVDKGTVVGNLAKHLNVNIRDLHARNLN
IVSGYSKKYFEANSKTGDLVVNERIDREELCPNTVKCTLNLEAILSDPVVLHRIEVVISD
LNDNAPVFLEKSYSLNISEWSPTGERFLLPLAVDADTGSNSVTTYRLNSNEYFSLDVQSG
DDQSASAELVLLRSLDREKQAVLKLTLTALDGGKPPKTGSLSIDVNVLDANDNTPTFSKS
LYKARVNENAPAGSPVIQLSATDLDEGDNGRVVYSFVKRGNFNPADVFVIDAESGEVTVK
AALDYETQSAFEVHVQARDKGFSPRSANSKLLVEVVDVNDNAPEIAVTSLVNPVKEDAEI
GSAVALVTVTDKDSGKNGKTRTEIVGSVPFKLLSNYKNYYSLVVDGPLDREKCSSYSITI
TAADEGSPPLSSTILVIVHVADVNDNAPAFSSPEVNIYVKENSPVGALIHTITATDPDKE
ENAIVTYSVMHGSRITQQKTWLISINSETGDIVSLQSFDYEELKTFQFQVQATDSGVPPL
SSNVSVNVFILDNDNNPAILAPYSEHGSVNSESIPYSAEAGYFVAKIRAVDSDSGYNALL
SYHLSEPKGNNLFRMGTSTGEIRTKRRMSDNDLKSHPLVVLVSDNGEPSLSATVSIEVVV
VESGADIQTPFRHNVPVKEESFSDLNLYLLIAIVAVSAIFLLSLITLIAVRCHRTDGGLG
RYGAPMITTHPDGSWSYSKSTQQYDVCFSSDTLKSDVVVFPAAFPPVDAELISINGGDTF
TRTQTLPTKEKPKMPSADWRYSASLRAGGVMQSSVHMEESSVMQGAQGVLVQNWPTASSA
ADAEGGEVSPPMGAGVDSNSWHFRYGPGGPGAPPQHLKPGEVPPEAFIIPGSPAIISIRQ
NQGGEDDKSDFITFGKKEEAKKKKKKKKEKKDKKDKGKDDGDE
Download sequence
Identical sequences H3CL97
ENSTNIP00000009026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]