SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009027 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009027
Domain Number 1 Region: 226-349
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-31
Family Cadherin 0.00052
Further Details:      
 
Domain Number 2 Region: 439-564
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-29
Family Cadherin 0.0004
Further Details:      
 
Domain Number 3 Region: 340-443
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-22
Family Cadherin 0.0029
Further Details:      
 
Domain Number 4 Region: 124-230
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-20
Family Cadherin 0.0036
Further Details:      
 
Domain Number 5 Region: 555-662
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 6 Region: 27-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000124
Family Cadherin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009027   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000009198
Sequence length 945
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:50512:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000009198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSPRRTVWLWISLFVVLDCLLEAVSGQLSYSVAEEVNVGTVVGNMAKDLNIHVQDLESR
MFQIVAGSKRKYFEVNLKTGVLYVSERIDREELCGAEPKCSLSVEAVLNNPLKLYRIEVI
ILDVNDNSPSFPSTSQAIDITESTSVGTKFPLHSAEDADVGKNGVNAYTVNPNEHFSLVT
YKGDIVSPELLLQKALDREKQSVIHLVLTVVDGGTPAKSGSMTVIVNVLDINDNPPVFSQ
TLYKARVQENAKIGTSIITLNATDLDAGQNGEVSYAISNLGRGKENDLFAIDAKTGTVTN
RKNIDFEKNNAFEIRVQASDGASSPLTSHAKLLIEVLDVNDNAPDISVTSLLNSVKEDAS
AGTAIALVSVVDRDGGKNGIVKCQISNNVPFKLESNYKNYYSLVVDGPLDRESSAQHSIS
IVAVDEGSPALSSTSFINVHVSDVNDNRPVFRENLFNIYVRENSPVGAVLKTVSASDSDT
DQNGHIKYSILQTSTNPQPLSSMININSETGDIVSLQSFDYEELKTFQFQVQATDSGVPP
LSSNVSVNVFILDENDNNPAILAPYSEHGSVNSESIPYSAEAGYFVAKIRAVDLDSGYNA
LLSYHLSEPKGNNLFRMGTSTGEIRTKRRMSDNDLKSHPLVVLVSDNGEPSLSATVSIEV
VVVESGADIQTPFRHNVPMKEESFSDLNLYLLIAIVAVSAIFLLSLIALIAVRCHRTDGG
LGRYGAPMITTHPDGSWSYSKSTQQYDVCFSSDTLKSDVVVFPAAFPPVDAELISINGGD
TFTRTQTLPTKEKPKMPSADWRYSASLRAGGVMQSSVHMEESSVMQGAQGVLVQNWPTAS
SAADAEGGEVSPPMGAGVDSNSWHFRYGPGGPGAPPQHLKPGEVPPEAFIIPGSPAIISI
RQNQGGEDDKSDFITFGKKEEAKKKKKKKKEKKDKKDKGKDDGDE
Download sequence
Identical sequences H3CL98
ENSTNIP00000009027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]