SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009028 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009028
Domain Number 1 Region: 234-358
Classification Level Classification E-value
Superfamily Cadherin-like 5.76e-29
Family Cadherin 0.00082
Further Details:      
 
Domain Number 2 Region: 448-573
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 347-453
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 131-238
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-19
Family Cadherin 0.0065
Further Details:      
 
Domain Number 5 Region: 564-672
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-17
Family Cadherin 0.0057
Further Details:      
 
Domain Number 6 Region: 35-115
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000742
Family Cadherin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009028   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000009199
Sequence length 940
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:84027:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000009199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSRLTMRNKTGFGSGHCCFIFHFSILLLVARILAQLRYSVPEEIQIGHPVGSVAKDLGLD
ISTLADRRFRIVPGPNHHLFQLNQDNGVLYVGKNIDREELCDGTKVCLINLKIVVESPLE
IHYVGVEIADVNDHAPSFPESEQRLEIAEHTPPGTRFQIHAARDPDAATLTVRSYKLSHN
DCFDIDIRESEEDKIPFLVLKKPLDREQKAQHSLTLTALDGGNPSRSGSLNLTIEVLDTN
DNRPVFSKDIYLVSLDENAQRGTLVVQLNATDLDEGLNGEIEYSFGKTQKKKVQDTFELD
SVTGEIRVKGNVDFEETEVFRLDIQASDKGHLPWTAESRVVIKIKDINDNRPEIEITSLS
TSVPEDAKPGTVISLISIRDKDSGLNGKVICKISGDVPFDLTPSIEENMYSLVTKGRLDR
ERVAHYDIIITATDCGDPPLSAVKSLTVYVSDVNDNRPVFNQNPFELYLVENNAPGASIF
SVSAVDDDLNENALVNYNIIRGDGLLNDLTAFLNINSENGQISALKSFDFETLKTFQFQV
VASDSGSPSLSSNVTVKVFILDQNDNAPVILYPVSSNGSAEGLEEIPRNVNAGHLVTKVR
AYDADIGYNGWLLFALQEVSDHSLFGLDRYTGQIRTLRSFTETDETEHKLVILVKDNGNV
SLSATATVLVKLVEPKEAFAASDVQSSAQDDEDSHVTFYLMITLGSVSVLFVISIIVLIA
MQCKSPDYTSKYVPETNYDGTLCHSIQYRSGDKRYMLVGPRMSIGSTIVPGSHANTLVLP
DRRRTNEEPKMPSADWRYSASLRAGGVMQSSVHMEESSVMQGAQGVLVQNWPTASSAADA
EGGEVSPPMGAGVDSNSWHFRYGPGGPGAPPQHLKPGEVPPEAFIIPGSPAIISIRQNQG
GEDDKSDFITFGKKEEAKKKKKKKKEKKDKKDKGKDDGDE
Download sequence
Identical sequences H3CL99
ENSTNIP00000009028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]