SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009029 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009029
Domain Number 1 Region: 461-585
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-30
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 246-372
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-29
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 143-250
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-21
Family Cadherin 0.0088
Further Details:      
 
Domain Number 4 Region: 359-464
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 575-680
Classification Level Classification E-value
Superfamily Cadherin-like 7e-17
Family Cadherin 0.0065
Further Details:      
 
Domain Number 6 Region: 44-139
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000243
Family Cadherin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009029   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000009200
Sequence length 969
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:120386:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000009200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSTFAMFWDGKSKMAHHRGHASQPGYVSFCLFISAFVNMVVGVTHYSIPEEMEEGSVVA
NLATDLGLEVKTLKERKMRIDVVGNKKYLDINKDTGELIVFERIDREFLCPSKTTTSCFI
RLDATIENPVRMFNIEVEITDINDNAPHFRRGTMHLDISESSSVGERFSLNNAADPDVGS
NSVKDYHLSASEHFSINIQTGRDGTKFADLILTKALDREMQAVHNLILTAVDGGVPTRTG
TASIVVRVLDVNDNAPSFDREKYVVDVMENSPIGSLVLKLNATDLDEGSNSDIVYSYSLY
TSERTQQVFHLNPENGEIRVREMINYEDLKLFEMEVIASDKGPNLLSGQCKLTIQVTDMN
DNHPEISIKSFQSPVKENIDVETVIAVVSVSDKDSGDNGVVDLHIPDKMPFKLRQSSDNY
YELVVSEPLDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDVNDNVPRFPQSFYTIRV
TENNAPGALLSSLTAFDPDLHENQYLVYFILEKEIANTSMSMLFSINPENGNLYALKTFD
YEIEKEFLFHIEARDSGSPPLSSNVTVHIVIVDQNDNAPVIVSPWRAQGSVVEEKIPRST
DKGSLVAKVIALDVDSVHNSRITYQLLQVTDATLFSLDQYNGEIRTMRMFSYRDPRHQRL
VVVAKDNGDPALSATVTIKLSTVETAVKAYSDMTEVPLEYDIFSDLNLYLVIGLGSVSFL
LLITILVTIVIKCQKPKASKAAPACRNSVISERNSTIADSTLVSNDAYWYSLFLAETRKG
KLVVRQPVPKGSRYIVSSIPRGTGLTDTSGSAPSTLQPKMPSADWRYSASLRAGGVMQSS
VHMEESSVMQGAQGVLVQNWPTASSAADAEGGEVSPPMGAGVDSNSWHFRYGPGGPGAPP
QHLKPGEVPPEAFIIPGSPAIISIRQNQGGEDDKSDFITFGKKEEAKKKKKKKKEKKDKK
DKGKDDGDE
Download sequence
Identical sequences H3CLA0
ENSTNIP00000009029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]