SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009076 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009076
Domain Number 1 Region: 3279-3384
Classification Level Classification E-value
Superfamily Cadherin-like 1.22e-31
Family Cadherin 0.00045
Further Details:      
 
Domain Number 2 Region: 411-531
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 976-1107
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-29
Family Cadherin 0.00081
Further Details:      
 
Domain Number 4 Region: 2220-2325
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 1393-1518
Classification Level Classification E-value
Superfamily Cadherin-like 7e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 3761-3944
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.44e-26
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 7 Region: 871-985
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 2966-3074
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-25
Family Cadherin 0.00092
Further Details:      
 
Domain Number 9 Region: 2745-2858
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 10 Region: 2012-2118
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 11 Region: 1088-1192
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 12 Region: 771-875
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 13 Region: 1706-1826
Classification Level Classification E-value
Superfamily Cadherin-like 2e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 14 Region: 3068-3172
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-22
Family Cadherin 0.0039
Further Details:      
 
Domain Number 15 Region: 666-778
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 16 Region: 3176-3286
Classification Level Classification E-value
Superfamily Cadherin-like 8.51e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 17 Region: 104-229
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 18 Region: 2119-2226
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 19 Region: 1505-1614
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 20 Region: 3379-3497
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-20
Family Cadherin 0.0032
Further Details:      
 
Domain Number 21 Region: 2429-2539
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 22 Region: 2860-2972
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-19
Family Cadherin 0.0036
Further Details:      
 
Domain Number 23 Region: 2327-2435
Classification Level Classification E-value
Superfamily Cadherin-like 7e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 24 Region: 1605-1724
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-18
Family Cadherin 0.0055
Further Details:      
 
Domain Number 25 Region: 1188-1293
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-18
Family Cadherin 0.0027
Further Details:      
 
Domain Number 26 Region: 2527-2637
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-16
Family Cadherin 0.0024
Further Details:      
 
Domain Number 27 Region: 1922-2024
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-16
Family Cadherin 0.0026
Further Details:      
 
Domain Number 28 Region: 2644-2745
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000811
Family Cadherin 0.0063
Further Details:      
 
Domain Number 29 Region: 1304-1405
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000006
Family Cadherin 0.0078
Further Details:      
 
Domain Number 30 Region: 522-620
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000903
Family Cadherin 0.0061
Further Details:      
 
Domain Number 31 Region: 1814-1908
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000209
Family Cadherin 0.004
Further Details:      
 
Domain Number 32 Region: 327-423
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000785
Family Cadherin 0.004
Further Details:      
 
Domain Number 33 Region: 3493-3584
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000118
Family Cadherin 0.011
Further Details:      
 
Domain Number 34 Region: 1-108
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000186
Family Cadherin 0.0024
Further Details:      
 
Domain Number 35 Region: 3942-3978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000369
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009076
Domain Number - Region: 3980-4014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009076   Gene: ENSTNIG00000006316   Transcript: ENSTNIT00000009247
Sequence length 4197
Comment pep:known_by_projection chromosome:TETRAODON8:1_random:810904:839682:1 gene:ENSTNIG00000006316 transcript:ENSTNIT00000009247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTQPVYEASIKENSPPRTYVETPAKTGIQLSLPHWELDYSVVSGDDDDLFQAEALKVGDF
CFLRVRTRSGNAALLNREVRDAYTLTVEATEKSSDLRAKTKVLVRVLDANDLKPLFYPAS
YSVSIAEDAELRSSVVTVSATDADVGSNADFYYSFTSRAHPFAVDPFTGTVSLVRKLNHT
RSQRYELTVLAEDRTKKISGVQKFGNVAKITVHVQKTSKASPVISQVSKPVVSADGKVTV
DVQVEAGVKPVGSLSVVGGDLCGCFTVIPSGAQGDRFQVISTKRIDWPQAPSGFNLSLQA
RDTSFPSLSSSVQQVHIAAAQISPLAFKESTYRVTLSEFSPPNTHVLLVSLSSEAHNASF
SIKDDPDGAPFRINPLTGVIVTTQKLDYESKRRYQFDVAANGGEAEARVVIEVKDENDNS
PQFASPSYEASLDENAPVGSSVLQVSATDADGGKNAFVTYALANSGPSPFTIHPFTGVIS
TSGHLDYELMRRRYHLRVWASDSGSPFSRVSECPVTITLNNVNDNIPLLERVGCNTTLPV
DAPVGGTVVQLSAIDPDELQQLRYLIQSGNELQVFAVDSVSGVISLKRAIPPSEGSFTLS
VAATDGRHQSEAAVVRVTVTHRGEEATVACQETGISKQLTARLIQSMEPFLAQEEDEAFP
DVHVTNRHSPKFDPVLPSSVELSEDFPLNSSVVRLRATDADSGFGSLLVYAISAGNQDGC
FSIDTFAGDLRLVCSLDRERNAFYVLNITVYDLGMPQKTAWRFVAVTVTDVNDNPPEFDQ
LRYVTRVPENAEVDSVVFTAHAADPDLDVGGRLRFSLLTPTNAFSIDPVTGEVTLKAPLD
RETTPRHDLQIVAKDGAERGPRLVSVVDLVVVLQDVNDNPPRFLPHNYKIKVPEDLPVGT
LLLWVESVDLDLASGGLVTYNLKNPEGGSFRLDSSTGALTLERELDFERRRSYTLTVRAV
DHGLPRSLSSSCFVEIEVLDVNENLHRPLFSEFVYEAAVMEDAAVGTSVLKLTASDKDVG
RDGEFRFHIQDGSGLGVFSIDEETGVICSAKILDREKMPHYWLSVLVGDLGTEPLLSWTH
VFLRVLDVNDNAPQLSQPVYFASVQENVDGVGSVAQVWATDADASSEGKLSFHMLESHRT
HFDVDPKTVKLTLTLSALDREEKEEHSVEVVVSDNGSPSLSSTTTVVIRVLDDNDNQPKF
TDKLFHIKIPEQRRSAGEQEVYRMVARDDDRGSNAAVTYRLQDDHSERFKIDPLLGVVTA
RGDFWPGNYSILTVKATDQGSPPRSSTARLDVEWIALPPPSDEPISFEEPHFTFAVMETE
PVTHMVGIIMTETYGQMWYSITGSGDEEKDFYIQRNTGTISIARRLDAARRSVYNMTVRV
TDGHQVATTQAYIRVLDMNEHRPVFSKSLYEVRVPEDTSPWKDILQVSAQDADASSKLVF
SIHNRQDQDSSTLFHLDPKSGVLVLKEELDYETTAVHTLILMVRDQEIPVKRNFAKVVVY
VEDCNDHAPTFLRRRYEANVQSGARSSQVVQVKALDEDVGSNAEIRYSILTGNVQDIFSI
HPELGSITASKPLHLHPQVQVHLSVKASDQGFPPRSLCSVHIHVHASGHAPPAFPSEELL
TEVSELGAVGTSVIAVSASSPAAVHYGIEKGNQEGLFAINPYTGLISVRKHLDFETRASY
RLEVSASTVGGASSSTFVSIYVTDENDNAPVFRQKEYLGQISEAADIGAMVTGEGSRPLV
IQASDADRDANALLVYQILEPELLSVFSIDPSMGTISLLSAVDFEARAEYRFSVQVRDSG
EPCRYAAEPAKVTVRVLDLNDCAPHFTSPVYESSVILPAVRGMEVTHVTARDADSAVAYS
IVEGNLHGAFSVEPSSGLITVSNATGFTGFYQLVLRASDGLHQDLATVRVNGSALTGGHL
GFEQDVYTVSVAENLRTVRTLAALKARGCLFNEPLVFSLLNPEGKFSISASSGVLETTGI
PFDREETDVYEVVVMVRDTRTPPRTARAQVRVFIDDVNDSPPQFSNLPFSIVIPESSEPG
DVLYQASAVDGDLGENASILYSLEEDYSLFRIDPHAGDISLQRPLDFEALNKYVLTVLAV
DEGEPSHSATAQLSLQVRNQSSPVFQTLLYPLKVPENIPPFTTILHVQARNPDGYRLVYN
LQEENASKHFHIDFKTGVLTVTDPLDYESQRAHVLTVRASDSVTGVFSEASVEIEVEDVN
DNAPVFSQRAYGAVVAEGLPVGTSVVQVSASDGDSGRNRDLTFHMLRTERNETEFFDIDP
HTGVIVTKQVLDHEGTNQFHLKIRATDNGTAPLSSEASVLVNVTDVNDNPPDFVSSQYEA
TLDEKAKCGHIVIKIQASDPDSGDLNKLQYKILSGNEGRYFNINQSSGIVSFSNVCRRNL
EPFYNLTVAVSDGVFQKTARVNIDMLSTNKHSPSFKQSVYEAELAENAEVGTQVIRLAAI
DPDEGLYGSVDYTIINKLADEKLAIDSDGQMVTTQPLDRENPAQRIIAVKVMAKDGGGKV
AFCTVRIILTDENDNVPQFAASEYQVSIQSTVNKGSPVVHIMAYDADEGRNADVTYTVDE
AEEATEDVIEINPFTGLVTVKDSLVGMENRIFNFKVQARDGSLPFYNATVPVQVRVLPPE
VPLPQFSEPLYTFSAVEDAPVGTEIGSVRAASNTPLIYSLVDGNTLENNKDKVFSLDEDS
GTLVLQKPMDHERTKWYQIDVMAQGNHNGTAVASLVSISIQVQDVNDNEPLFDASPYRAF
LAENMPAGTTVIQVTANDADSETNGLVTYSLEALPEEEEEEAGATEMFSIDEESGWITTT
QEADCEAVRVYRFSVVATDNGGGLRLSSSVLVEVTVTDENDNPPKFSLEAYRGSVVENSS
PGEVLVSMTTADADVSLENRLVTCYITDGDPLGHFAIIQQSEGGWGLILTQPLDREVKDR
HALRVMATDGKFQASVSVDVHVLDINDNSPQCEQLVYTEAVMENSPSSRFVLKVSAVDPD
VGANGQVSYSLHGPNADKFHLNYRTGELLTLAVLDREAEPEYNLVAKATDGGGRSCQSDI
LLMIQDMNDNPPRFSSSHYQLTVFDNTTVHTPIAVLYAKDPDTCCPGINAEVKYSLLSGD
SSFFSLDEFSGLLRLERPLTPDAPPTFELKVKATDRGLPRHLYSIATVTVAVVSLDDYQP
VFLSSEYTAQLPESFAVGSQVLSLSALTRDGGGPDPVAYRIVSGNEDGRFLLDSRTGLLT
LVAPLDFEASRTYYLSVEGRRGKQTLSDITTVMVNVTDVNDNAPVFEEGGYRVEIKEDLP
PGSLVMKVTASDQDGPSNSLLRYSIVSGDPLQQFSIHPRSGEISVAAALDREEVPHYSLT
VQAADGGDPPLSSAILVTITVADVNDNPPIFSRVNHSLLLQEGEPVGSSVLQLVVTDRDT
PRNGPPFSFHIVSGNQERRFHVDQGGLLSLSAPLRKKVKGHHQLKIQVTDSGHPPLSSIC
VVDISVTEQSRYPPSVVPLEVFISTSGGLFANQVIGRLHASDQDLQDVLTYQLTSQSPAD
GRFSIDPADGKLWADGSLEEGFYSLNVSVTDGRFSVWTGVKVHVWAAEQKVLDSGLSLRL
DGLSPEEFLGDHWRGLQRSLGQALGLPRQEVHLASLQQLQTSRNLEALLVWRSPAGPAQP
LLPNRLAGLLSDIEDSLGLSILRVKHNGCLGAGCPPRGCRNAVRLTAELPSHFSTARASY
ITPHHRWESVCPCNGEPPPPRLGRDRDEPGSLIICLSGLAESAVEFDGGSYLRYLHGMDE
DEQDFRLALSFKTLQERSLIVSTNSTKDWGVLQVTGGALGFRFACGSAAPRSLMISSGPV
SDGQWHRVLLEVNASALRLTLDQRPSASAALAQPCRMLPSQGALMFASSPTPEDAQLLPG
FIGCLRGLALNSQPIRAGDAGEWAGPGKRQVFGVYRCCSSAGACDSSPCQNGGACEEDAS
GGLRCRCAGLFHGARCELPNNPCASQPCAHGHVCVPKARGYMCNCSLDDAQARCPGEAAA
CSPSACPGGFACQVSEGSLHCDLLPQVSPPIGYTEILEISASVLGLLLLAAIFVCIRKRY
LQRAVSRTPTAQQEPTWTGRRNWAGDGRRVLTQSSAPSQILPDQPEGQQPGSWSEMSSLV
GPINDLDSTPFRSLRPQSPGVSFPKTQGPVVCSVAPNLPVRPPSSSDNDSIRKNHWD
Download sequence
Identical sequences H3CLE7
99883.ENSTNIP00000009076 ENSTNIP00000009076 ENSTNIP00000009076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]