SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009146 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009146
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Sema domain 0.000000000000157
Family Sema domain 0.0088
Further Details:      
 
Domain Number 2 Region: 102-154
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000458
Family Plexin repeat 0.003
Further Details:      
 
Domain Number 3 Region: 428-531
Classification Level Classification E-value
Superfamily E set domains 0.000000000471
Family Other IPT/TIG domains 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009146
Domain Number - Region: 528-561
Classification Level Classification E-value
Superfamily E set domains 0.000484
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number - Region: 257-298
Classification Level Classification E-value
Superfamily Plexin repeat 0.0034
Family Plexin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009146   Gene: ENSTNIG00000004812   Transcript: ENSTNIT00000009317
Sequence length 564
Comment pep:novel chromosome:TETRAODON8:Un_random:71975460:71980592:-1 gene:ENSTNIG00000004812 transcript:ENSTNIT00000009317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGGEHTPNPIASAVPLQATPTFNSSIQLTAVTTATEAEHTIAFLGDREGHLHKLTRGFSG
NTATCWATFATADELPSFRTNSQQHLYVLSNSRLSKVPVSSCEGQTDCQSCLAVRDPYCG
WCVLEGRCSRKHLCRRHSQPNHWLWSFEPTSGCVAVQSLQPARQSRDQQTQVTLSVGRLP
ALAEAESLSCVFGLLPPGPAIVMGTSITCQSPVPELLQPMQAGSDHMALPVSLVFGHVTI
ATSSMTFYDCAAVSRLNQSSQCLACVGSAWGCNWCPLDQLCTHNLSCPSQHIILSQRVRQ
SRLVPHQFSVATRSSAVVDEGAVSSCDPGESLMCQWYDKGSPGSGTQGSVLCPADGSEYS
VPVYLRRGERRIDASPGLRIQLYDCSAGQSDCSQCRAVPAEYGCVWCPGSPSPSCVYNQS
CSSTPEDSCPPPQITQVQPVSGPLEGGVLVTITGSNLGMRYQDVVGGITVAGIWCPPFRP
KGTRSPPGLSAALSVVCELQPSGKQREGPVQVRVGAAPPGRSLQVFTYQDPQLLGLVPDK
GPVSGGTRLTIRGRQLLTGQKWDL
Download sequence
Identical sequences H3CLL7
ENSTNIP00000009146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]