SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009157 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009157
Domain Number 1 Region: 6-75
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-17
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 280-347
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000396
Family SPRY domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009157   Gene: ENSTNIG00000006391   Transcript: ENSTNIT00000009328
Sequence length 347
Comment pep:novel chromosome:TETRAODON8:2:155376:161248:-1 gene:ENSTNIG00000006391 transcript:ENSTNIT00000009328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKLKAPKDLFCSVCLCIFQTPVMLQCGHSFCRSCVLQTWAGKLSRKCPLCEQVSAEGPPQ
VNFSLKSLSESFLETHAEPAAARRDDSPRVIPHDAAAAARCLTTTALTQKSPDTHTHTQL
SFIPCLQVSAGTFGLLSRRLLQFRLLISHSSPRRSERSRRSFRRQSRATEMKIREEFEKL
GRCLKTEEANRLAALKQEEAQRIRLIQMIMEASRDTFSLSDTVKNMEELVTGGSFITVAE
LQVFFGKVGIHPPASLGKSHVQIDEAKYVDNLQLRVLKKMLRIIKNNSIGLTLDPNTAQR
DLFLSEDNRKARRWTKQKYPAHPDRFEFWAQVMSTEGLTGRRYWETE
Download sequence
Identical sequences H3CLM8
99883.ENSTNIP00000009157 ENSTNIP00000009157 ENSTNIP00000009157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]