SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009176 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009176
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.94e-45
Family Astacin 0.00025
Further Details:      
 
Domain Number 2 Region: 357-521
Classification Level Classification E-value
Superfamily TRAF domain-like 4.8e-23
Family MATH domain 0.0025
Further Details:      
 
Domain Number 3 Region: 194-358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-20
Family MAM domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009176   Gene: ENSTNIG00000006408   Transcript: ENSTNIT00000009347
Sequence length 533
Comment pep:novel chromosome:TETRAODON8:8:758588:761345:1 gene:ENSTNIG00000006408 transcript:ENSTNIT00000009347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWQSPVPYVLDKSLEMNAKGIILQAFDQFRIKSCIDFKPWDSERFFLIMKKLDGCFSYVG
KVMANGQELSIGASCDSISIAEHEILHALGFYHEQSRYDRDDYVEIVFENIQSGKENNFR
KVNKNDSITNGVPYDYLSVMHYGKNAFSNGIGPTIVTKDPAFQDVIGQRLEMSPSDVLEL
NRLYNCTSSVAFMMGCSFSGGSACEMSKCEDGDVVYFKSPPKHINTNHSIISVPGVGYFM
HANTAAGMEGDSAWLETKRLTPTRSCPVQCLQFYFCQLGNQTDQLNIWVREFQDERDQTG
TLRLVDQITGDKIDLWRIHHVSLNATKPFQVVFEVRKGAGNSSGGFSIDDINLSETRCPD
FTMQFDHFEALIQTSKINTAIYSPRLYSPGGYAYRVGILLQAPSFALFVQLLSGENDERL
EWPCPRRQVTSTMLDQSSNIQQHMSKQRSFTSDLSTSTAGSYLWDNPRKIGNPFTDKNNE
TIYGGPWLSFGHFSSLTEIREREFVKGGSTVFTFKFDDLTPLVNGSNLPCPGM
Download sequence
Identical sequences H3CLP7
99883.ENSTNIP00000009176 ENSTNIP00000009176 ENSTNIP00000009176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]