SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009178 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009178
Domain Number 1 Region: 164-337
Classification Level Classification E-value
Superfamily E set domains 1.87e-45
Family Cytoplasmic domain of inward rectifier potassium channel 0.0004
Further Details:      
 
Domain Number 2 Region: 48-180
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-21
Family Voltage-gated potassium channels 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009178   Gene: ENSTNIG00000006410   Transcript: ENSTNIT00000009349
Sequence length 337
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:36320597:36322958:1 gene:ENSTNIG00000006410 transcript:ENSTNIT00000009349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTSNSRVLGGKVSCSPLLSFPPRQRLVTKDGHCLLPPSLSPPGSKRWFSRGSWLLALH
DLWGLLLGLRWRWVLLAFCISFLSHWLLFACLWYLLAHLNGDLAVKDHDAPPQGHVVCVK
HINSFTAAFSFSLETQLTIGYGTMFPSGDCPSAIALLAVQMLLGLMLEAFITGAFVAKIA
RPQMRAGAIRFSPYAVVGQHQSQKCLMLRATNLLQHPIVDVKVSAVLYEEYEGEVLHQTS
VDFHLDQLGQQPCPLFIFPLTFYHPPGPSPLYPTLCEGRNNHFELVVFLSALREGTGDIC
QKRTSYLRQEIQFDRRFLPALVLDEQGRYLTKLQHFD
Download sequence
Identical sequences H3CLP9
99883.ENSTNIP00000009178 ENSTNIP00000009178 ENSTNIP00000009178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]