SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009203 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000009203
Domain Number - Region: 263-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0464
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009203   Gene: ENSTNIG00000006435   Transcript: ENSTNIT00000009374
Sequence length 467
Comment pep:known_by_projection chromosome:TETRAODON8:21:789566:797508:1 gene:ENSTNIG00000006435 transcript:ENSTNIT00000009374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGDARLPTWQVLLTISMVLTPGFAHGRHSLARRYHHHNQSSLNKEALNTRMVLSDDSA
ERDHLIGAGLGLGAKLPLGSKRLRPHKRAHLDILEEDPPAGEELTAGGAGPDQPGNPMID
DVITVEFHSPAPDVVPADVALDWAKVAKPQKQKGGNPPAWGLSDFYDYSPDDDLSAVDVT
PEPEPSPSPPADMEDENPLLAGSPAAPVDARPKLKPAPTSPSTQSPAHGESDGLGVGGAM
GADGCRLGFVLSGPGVCVSQCDVEPNFCFNGGVCTVVAGTGAFCRCNVQDYIWNKGTRCD
WAVTEFQVMCLVVGVASLVLILLFMIVVFFAKRLHRLKNENRRLRRHSKYRPQSSEPQTD
GLSVSTTADGSQPNVRKLCDTPPPAPQAHTHNLAYYDNIICQDEPQKQIQEPAKSPQAKE
EGSMNILNSHSPKQENNRPSSVIHDQGRAPNNAEEYTEVNMLQNNLV
Download sequence
Identical sequences H3CLS4
ENSTNIP00000009203 99883.ENSTNIP00000009203 ENSTNIP00000009203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]