SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009212 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009212
Domain Number 1 Region: 19-132
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-22
Family V set domains (antibody variable domain-like) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009212   Gene: ENSTNIG00000006444   Transcript: ENSTNIT00000009383
Sequence length 166
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:19439152:19443816:-1 gene:ENSTNIG00000006444 transcript:ENSTNIT00000009383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVMVFVTSAPSPVSSITVKTPADLQASKGDTVTLSCTFISSSTPTSKMTVDWSYRPPTGG
PPQTFFHFSSRAFLPLEGQFSGRIRWRGTPARSDASISLVNATLNDNGTYTCSVRNPPDV
HGSPSSHTLLTVTPKAPSIRFSDVTVLLVFILLPSTIITFFLLGRM
Download sequence
Identical sequences H3CLT3
ENSTNIP00000009212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]