SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009225 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009225
Domain Number 1 Region: 515-633
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-22
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009225   Gene: ENSTNIG00000006457   Transcript: ENSTNIT00000009396
Sequence length 640
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:37581027:37584786:-1 gene:ENSTNIG00000006457 transcript:ENSTNIT00000009396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVVSAPLIIASSSSHTHASRREIHTDTLVFIQSADTPGALIFYTLDGSRPEPDQSGS
AARSRKYSKPVRLPAGRVAVRAVAVASDGRRSSTVTKMFVVQSLPGSPGVGPAALEPVLL
SPAGLWMGGDGSVLQNGPHPEVGEPASLPQKPVHGPPSGPVQGSDPLKQLRSTQTSRLVQ
DPEVLWDQQVLTDADLLRNTERVRAQANWSARPPDPFSLFFPICGAKISHQTFPSRGTEQ
GHRVCGCCGSGNPVNVSSCLTCESCLQPQREPSSSGCWLASEDLAPWCGVSGPAPSLAAP
ACCAGAAAPAAILPPPGCASCGHAPARLRLEDAPPTADRSTQTVGLFYPAATQRQQSGRT
PQPSRRPPLTSVSPGKGYWRRQLDHVCAHLRSYTQNNAPFRALLGDPCMGQLLSAVVQDD
QQQLTLTISFALAHQKTQVCGSTCTSSSTTPTQTGLGEGLDLFRSGSCDLPMGVWGEVHP
HSHTHTRRGLTGGDVLPGGGASKPGRGRDAQLMMELAPGRGQLSIVQQLLDQGADPACCH
SNGRHPLALAVLNGHHQVLPELVQRGAPVDQQSGPMKNTALHEAAALAPEGLPAAELLLS
CGASVGVKNASGQTAFQLAADSGCNQMVSLLAAQTGLVLL
Download sequence
Identical sequences H3CLU6
ENSTNIP00000009225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]