SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009249 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009249
Domain Number 1 Region: 156-352
Classification Level Classification E-value
Superfamily E set domains 7.93e-71
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000215
Further Details:      
 
Domain Number 2 Region: 49-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.1e-19
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009249   Gene: ENSTNIG00000006480   Transcript: ENSTNIT00000009420
Sequence length 415
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:23176893:23179008:-1 gene:ENSTNIG00000006480 transcript:ENSTNIT00000009420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARKSIIPEEFGLSGLVSRVPRKPVFRDRVNKARFIAKNGSCTLAHKNIREQGRFLQDV
FTTLVDLKWRYTLVIFTTTFVSSWLLFAMCWLVAFAHGDLDPERQNRTNCVTNVTSFTSA
FLFSIEVQVTIGFGGRMITEECLAAIAFLITQNILGLIINAVMLGCIFMKTAQSNRRAET
LIFSRHAVIAVRNNRLCFMVRIGDLRKSMIIGATVRLQVVRKTTTPEGEVIPIQQIDIQT
ESAITSNSLFLLAPLIICHVIDKTSPLYDLSAMELQCSDLEVIVILEGVVETTGITTQAR
TSYVSEEILWGHRFVPIVTEEEGVYSVDYSKFGNTVKVNTPLCSARELDEKPSILIQTLQ
KSELSHQNSLRKRNSMRRNNSMRKSTGSLRRNNSNLAKVQFFTPGDSVQNLNAVT
Download sequence
Identical sequences H3CLW9
ENSTNIP00000009249 ENSTNIP00000009249 99883.ENSTNIP00000009249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]