SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009270 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009270
Domain Number 1 Region: 7-265
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-56
Family Ankyrin repeat 0.0000451
Further Details:      
 
Domain Number 2 Region: 534-605
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.67e-21
Family SAM (sterile alpha motif) domain 0.004
Further Details:      
 
Domain Number 3 Region: 467-531
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.61e-16
Family SAM (sterile alpha motif) domain 0.0039
Further Details:      
 
Domain Number 4 Region: 266-349
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009270   Gene: ENSTNIG00000006501   Transcript: ENSTNIT00000009441
Sequence length 1326
Comment pep:known_by_projection chromosome:TETRAODON8:3:15354723:15369262:1 gene:ENSTNIG00000006501 transcript:ENSTNIT00000009441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPEQELLQAVKSADLQTTTKLLSKLRTSRSKLLGSTKRLNINYQDSDGFSALHHAALTG
TTELLSALLEAQATVDIKDSNGCMRPLHYAAWQGKAESVLTLLRAGASVNGASLDGHIPL
HLAAQYGHHQVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRVQVAQLLLSSNMVVALLEG
ERKEQTDSAFTTPLHLAARNGHKDVIQLLLKASIDINKTTKSGTALHEASLYGKTEVVRL
LLDAGVDVNIRNTYNQTALDIVNQFTTSHASRDIKQLLRDATGVLQVRALKDYWNLHDPT
ALNIRAGDVITVLEQHVDGRWKGHIHDAQRGMDRVGFFPPSMVEVISRRNGGRTGVRSPS
LGPSESLCLLGCSLASEEIWVLRKSGAPAGDRSSVGSTGSVGSTRSAGSGQSSTGGDGPR
VWSTCIRSTEPRGAALVPAGGSRRSTVTVQRPAEPSFSQQFVRPQQLLEGKDAEAIYQWL
SDFQLEHYTGNFVSAGYDVPTISRMTPEDLTAIGVTKPGHRKKISMEITNLNIPEWLPEF
IPSDLGEWLSAIGLSQYHKKLSENGYDSISIVKDLTWEDLQEIGITKLGHQKKLMLAVKK
LCDIQKVLLQAESGPGTLRRKAPRALQLVAIEAPDSSGECSSPRTPRMQTFQDSELSAEL
QTAMSSHSGGCEQSLAIKKAAGMSRSQESMDTRSRGSGRSQDPTASSTPHSWSQESLDPS
LGKERDLPEGYDQRPLQQQVQPKQVPLGTATVFKYPAVPAKPKLAGTSGVAPRGSPALRG
FSYLRSHSGSTDMSPPLKDRESNTTTPPKSRAQSLTRYALSDGEPEEDEEEPALPPAHLS
SYATLTRKPGRSQLARLKSSPEKNVGRSQSFAVRARKKGPPPPPPKRLSSVSSSTSGELS
DSSTDLPAGGAATSPLSVRTMAASLEGRTGGENDPAPSQNPPAISAAGPGSREGSGLRRR
VQSECVSTQTSSRSEADQGVKSDSEEEESKESGLKGSSSPNSSSKTEGSGPPRAEAVLEP
PEKAPARSPEVPEFNLKESDTVKRRHKPKDKEPDKGPPPPPPKRLSSEGNLTIKQRPKVP
GPPRAEAVLEPPEKAPARSPEVPEFNLKESDTVKRRHKPKDKEPDGGCHDQEVTTTPGTH
GWVFSPSQEEVRSSKTATSLESPAAPAAGSPVKPAVPSKPPATAPKPVRHSLLAAQGKTV
DAEVDPGPVDLRPVDLRPVESGPVDLRPVHGPPAPGPGWVSAPQSPCLTSARSQVHLQGR
GLGTEVVQQRLDQTSWSLAAALKAVESKLSQEEDSSRNAVTSARTILDDIGNMFDDLADQ
LDAMLD
Download sequence
Identical sequences H3CLZ0
ENSTNIP00000009270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]