SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009288 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009288
Domain Number 1 Region: 7-207
Classification Level Classification E-value
Superfamily L domain-like 1.93e-37
Family Ngr ectodomain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009288   Gene: ENSTNIG00000006518   Transcript: ENSTNIT00000009459
Sequence length 273
Comment pep:known_by_projection chromosome:TETRAODON8:9:10446059:10448303:-1 gene:ENSTNIG00000006518 transcript:ENSTNIT00000009459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIAPVHSCPSSCLCPDPHTVDCIGRGLTGVPDSIPLDVRRLLLSNNWIAWIPSDFLVLYS
DLVYLDLRNNSLSQLEPGTLTTSSRLVFLDLGSNNLTEIPSGTFGESRSLIKLRLGNNPH
LTMVGSGAFTGLTSLRELELDRTGLTQLDVDVLEALPSLRVLRLEGNPWLCNCRFAKLFV
WMLQNRHKLPKGLEELDCSLPLDGRRVPLTSLSEESFRGCHSSLTLTDYLVVIFSGISVS
VAAIMASFFLASTVHCFQRLSKGSQDEEEEGND
Download sequence
Identical sequences H3CM08
ENSTNIP00000009288 99883.ENSTNIP00000009288 ENSTNIP00000009288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]