SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009298 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000009298
Domain Number - Region: 4-63
Classification Level Classification E-value
Superfamily vWA-like 0.0185
Family Integrin A (or I) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009298   Gene: ENSTNIG00000006527   Transcript: ENSTNIT00000009469
Sequence length 242
Comment pep:novel chromosome:TETRAODON8:Un_random:87064265:87065450:1 gene:ENSTNIG00000006527 transcript:ENSTNIT00000009469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPVIQENVKAAIGGQMSLFSLGFGNDVKYPFLDVMSRENNGLARRIYEGSDAALQLQGFY
DEVSSPLLLDVDLRYPDNAVDSLTTNQFSQLFNGSEIVVAGRRKDNDIDNFPVQVSGQGQ
SNDFSEQGRFSALDWSGMYPDDDYIFGDFTERLWAYLTIQQLLDKSKTGDAEEKANASAE
ALDMSLRYSFVTPLTSMVVTKPETDDSPMIADKLTEEQRQQAERAGNYNYGYSAPPAPPT
YF
Download sequence
Identical sequences H3CM18
ENSTNIP00000009298 99883.ENSTNIP00000009298 ENSTNIP00000009298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]