SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009316 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009316
Domain Number 1 Region: 12-189
Classification Level Classification E-value
Superfamily vWA-like 0.00000000741
Family Trunk domain of Sec23/24 0.07
Further Details:      
 
Domain Number 2 Region: 506-615
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000011
Family YkuI C-terminal domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009316   Gene: ENSTNIG00000006543   Transcript: ENSTNIT00000009487
Sequence length 906
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:87118975:87128172:-1 gene:ENSTNIG00000006543 transcript:ENSTNIT00000009487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPVYVSAVRPQSKHIVVMVDHGASVTDTQLQIARDSALIILNAIDEHDKVSVLSVADAVR
SCSLDQCYRSLLSPATSETKRKMSTFISNIKASDGATQHAAGFQKAFQLLRNTSSLSKQS
ATTDVVIIYLSSGVTSRESSEQEKRATLSVVREENRHLNNSAMILTYALMNEGVTGLKEL
AFLRDLAEQNWVKYGVDRSSDRDCPAGASMMPVVKGGMMVLNQLSNLETTVGRFYINLPN
RMIDLARFSLPYTDPMGDGFIMTVSRPCYFGNLLLGVVGVDVNLAYILEDVTYYQDSLAS
YTFLIDNKGYTLMHPSLTRPYLMTEPPLHTDIIHYENIPGFPAVRQNILGLPLGSQIITV
PVNSSLSWHMNRLRDVSKDAYNVSYAWKLVQDTSFILCIVYVQPEIPVKQLKNLNTAPSS
KLLYHRLDLLGQPSSCLHFKQLATVESPTVMLAAGSFSSPYEHLSQPETKRMVEHYTAYL
SDNTRLIANPGLKSSVRNEVMATSHVTDEWMTLMEMSSLNCYIVRRYIATPSGVLRIYPG
SLMDKAFDPTRRQWYQHAVANPGLITFTGPYLDVGGAGYVVTISHTIHASSSQMAPGYAV
AVMGIDFTLRYFYKVLLDLLPICNQDKGNKIRCFIMEDRGYLVAHPTLIDPKGHAPAEQQ
HITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQRFYKFNTSIMGDLTNLVHGSHCSKYR
LTRIPGTNAFAGIVNETCDSLAFCACSTVDRLCLNCHRMEQNECECPCECPLEVNECTGN
LTNAENRNPSCEVHQEPVSLNVIDPTLQDTLPQCINTRCSQRFSSSDCFGVLDCEWCTVD
SDGKTHLDKPYCALQKECFGGIVGAKSPYADGLGLMDEEVASLNMIKSAPVGPVAGGIMG
CIMVLV
Download sequence
Identical sequences H3CM36
ENSTNIP00000009316 99883.ENSTNIP00000009316 ENSTNIP00000009316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]