SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009364 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009364
Domain Number 1 Region: 149-435
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-75
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 39-100
Classification Level Classification E-value
Superfamily GLA-domain 5.38e-24
Family GLA-domain 0.0004
Further Details:      
 
Domain Number 3 Region: 91-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009364   Gene: ENSTNIG00000006590   Transcript: ENSTNIT00000009535
Sequence length 442
Comment pep:known_by_projection chromosome:TETRAODON8:3:1185854:1188062:1 gene:ENSTNIG00000006590 transcript:ENSTNIT00000009535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRGCCTVWLLFSVAAAVPVFVERDDASAVLQRRRRANSGFLEELQQGNLERECIEEIC
NYEEAREVFEDNVQTKKFWESYNRIDACLAQPCQNNGVCVSMGNAYQCLCPEGFNGRHCE
TKVEDFLKCLYQNGQCQHFCNSSRESHKCYCAEGYKLAADGRQCVAEVEFPCGRLPPPET
GPEQPVVGQTRLVGASHCPKGECPWQVLVQLHGLSHCGGVLIRPDWVFTAAHCVTGKQPQ
DLLVVAGEHNLDIDEGTEQKTPVATVFVHEGYVSETGDKDIALLQLNTSVSLNRGVIPVC
LPTRDLAERELQMTRYHTVSGWGKRTSGGNVDPSAINTAPVSPFLRKFSVPIIPNAQCSY
RSQFNFTDNMLCAGYLEGQQQSCRGDDGSPLVTLYGSTHFLIGVVGWGRGCPKPGYYGVY
TNVGNFADWANGIMAEAGGKTT
Download sequence
Identical sequences H3CM83
99883.ENSTNIP00000009364 ENSTNIP00000009364 ENSTNIP00000009364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]