SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009366 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009366
Domain Number 1 Region: 158-428
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.59e-84
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 2.52e-21
Family GLA-domain 0.00072
Further Details:      
 
Domain Number 3 Region: 100-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000081
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 136-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000352
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009366   Gene: ENSTNIG00000006592   Transcript: ENSTNIT00000009537
Sequence length 430
Comment pep:known_by_projection chromosome:TETRAODON8:3:1179790:1182262:1 gene:ENSTNIG00000006592 transcript:ENSTNIT00000009537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFSRAAKRLFFLKLLIVTVPACSGFLEAGLFMEKPKASVFLHRTRRANVLFEELRIGN
LERECLEEKCSYEEAKEIFALPQQLEAFWRTYTAVDQCLSSPCKNGATCTRHFETYACKC
AHGFHGHNCDKVRLSSNGCRYRNGGCEHFCREFPDRSYVCFCAPGYGLDQDNSTCLPQVR
VPCGRPQIHFSPRVINGLVCPKGHCPWQAMLSENNVFKCGAIVLSEQWVLTAAHCVWRKP
ATIFNVTVGEHDRTVVEKTEQHRQVVKVFIHPGYNKTNSDKDLAVLKLHRPVKLGLYVVP
ICLPAQNSSISRTLANVRHSTVSGWGRLSRYGPPATILQRLMLPRVPLQECRLHSKLNIT
RNMLCAGLKTGGSDACEGDSGGPLVTRYKKTWFLTGVVSWGKGCANENLYGVYVRVSNFL
DWIADIVATN
Download sequence
Identical sequences H3CM85
99883.ENSTNIP00000009366 ENSTNIP00000009366 ENSTNIP00000009366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]