SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009374 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009374
Domain Number 1 Region: 55-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-29
Family Ankyrin repeat 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009374   Gene: ENSTNIG00000006600   Transcript: ENSTNIT00000009545
Sequence length 376
Comment pep:known_by_projection chromosome:TETRAODON8:3:1114296:1121813:1 gene:ENSTNIG00000006600 transcript:ENSTNIT00000009545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPKGKRPCKTKHTEGSLVTKRRKWEEPKPRRTERDTNAKPPASSAPADSTSCRPPTPLHT
HPTRQIPPEVRRLIVNKNAGETLLQRAARLGYQDVVLYCLEQQICDVNHRDNAGYCALHE
ACAHGWLGIVRLLVEHGADVNCSAQDGTRPLHDAVENDHVEVARFLLACGADPTLTSYSG
RGPINMSHSATMETFLEDYLSDLQGRSEGDQGIFWEFYGSSVFESSNGGEVYNILADPPG
PDEEEDDEEDDDNRGQRARREVFEFELSDRPLLPCYNVQVSLSQGPRNWLLLSDVLGRLR
MTSRSFRRLFPQLNVQSVPEDEFYRQASLSQLLTGPDEQELASFRPDIKDPLELVEATPE
LAGMLGSSLEFVDTRY
Download sequence
Identical sequences H3CM93
ENSTNIP00000009374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]