SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009376 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000009376
Domain Number - Region: 96-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009376   Gene: ENSTNIG00000006601   Transcript: ENSTNIT00000009547
Sequence length 276
Comment pep:known_by_projection chromosome:TETRAODON8:3:1071644:1074084:-1 gene:ENSTNIG00000006601 transcript:ENSTNIT00000009547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSRLRFGKPVPRGVTNVVYLILEDFANTAYQKMNLAIDKYSLDVESGDWADPCKFQACNE
FSRCAVNRWSGEAECVCDAGYLSVDGLPCQSICQVQSDFCLNDGKCDVLPGKGAICRCRV
GENWWYRGEHCEEFVSEPLVVGIAFASVAGFFTMALLIIYFLAKMLREQYNSEDTEDPYC
SPTLQRVADDPVTAQYYRRFDDNMPQFLPHSGQSHRYSSSVFGDGFKELSNEEMRHIYQN
SSLTEEEIQERLRIIRLCTRDRSFADFVQQTQVEKL
Download sequence
Identical sequences H3CM95
ENSTNIP00000009376 99883.ENSTNIP00000009376 ENSTNIP00000009376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]