SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009411 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009411
Domain Number 1 Region: 10-171
Classification Level Classification E-value
Superfamily RUN domain-like 3.14e-40
Family RUN domain 0.00055
Further Details:      
 
Domain Number 2 Region: 1340-1454
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.92e-28
Family Supernatant protein factor (SPF), C-terminal domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1147-1210
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.34e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009411   Gene: ENSTNIG00000006634   Transcript: ENSTNIT00000009582
Sequence length 1456
Comment pep:known_by_projection chromosome:TETRAODON8:1:14265310:14274311:1 gene:ENSTNIG00000006634 transcript:ENSTNIT00000009582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGTVGESQLQRIIRDLHEAVAELSKEYRENGEPITDDSSSLHKFSYKLEYLLQFDQKEKT
TFLGTKKDYWDYFNDCLAKVKGANDGIRFVKCITELKTSLGKGRAFIRYSLVHQRLADTL
QQCLMNQRVTSDWYYARSPFLKPHLSVDIINHLYELNEIQFDVAYRGHDLDASWPTFARR
ALGSANSPGHMWKPPSRSSSINSLASSYSQGQSLLNDLNESLPPCREDMSTVEDLRLELD
QSELKHRALLDKVQQLSEEAAELRGVVVELQRQLDASLSAHEEQQDLQEELKVLQEREKA
LTREVDTVRNREAAQEAEQQLLQKKLTAAEGKNVELLAKLDGVLNEKGQQAASFFDSAQK
IHELLDISKDAETRLGALVASASEEKVKLEAKVEQQIAAVDNLQGALTLREKETSNLQKQ
LQDLQDILEKKEKELQEVKLTADKDQDIMQKSLSSLKKSFETKVVALEEQLQKNKAEIHS
NHETLQELEAKNQTLSEDRGKLTTNVVELEGNIKEQGLKIEDYKMQCASLMELNEKLLAT
VKRNEELMKEMAENRLALENELAALRSSEKHLRGQLDDAKMTVDEKEKHLREENRMLDES
LQRSNVAAKMSEAMSKRLERENQSLREEQETVKAALGQMQADLKRVHGQIADLEKNLGVS
RKNETSLQEQLQAKDAQLDSKEKTLVELQSRVKTLETREKELEKTKTDVEEMCAKQSEMF
ERVSSEKQTVEKSYLERSESQAKENQEVKAKLTLAESQLEVSLGDVSRLQSEILDLKVEF
KKSEEEKLKFQAQLEVTEAQRNELRTLTEQLKAQAEALNQSHVAELMECRKKEEELNERR
DKELAAHAELAISTTALREELATAKAENARLAAENGEIREGLHRANTEMAELGMTICRLG
AEKEEVQEHWQEDTAKIEELVREMERVERGMEELQLENDRLREELREREDLPETLKELQK
QLDEATEEMQKTKESSREEKEAIKFQMSSESMNHQLHKRSLNEQLDKVTAELEEEMKRVS
CLEARVSELEVRLPNLLGEKDARVTKNEATICENADEIRRLTEAASRAEEAHAAAQKTCQ
ELKQKLSSTEAEKANQLLTMSAEIDDLSRTKSNLEERLIELIRDKDALWQKSDALEFEQK
LRAEERWWLVDKEITHCLDCQSQFTWWLRRHHCRLCGRIFCYYCSNNYVMTKQGGKKERC
CKECYTELSPSDSQPPPPGAEPQSPPEPAPYKATPRVTGGRQPSVSEPSNRSDDGAFDII
TEEEVNDVYDSDTTSQTVSLDGEQDRRPHGALNTGAGDMTPDDLEDHVPTVQDSEINLLK
SGEITLAVLLSIEDISGFGDGLRELFIKSSSYSVITIDVSDTGPTISWMFSSEPKSISFS
VVYRDSADTQVEHSKVLIPLTRCSSHKETIKGQLKVRHAGLYSLVFDNSFSRFISKKVFY
HLTMEKPIIYDGSDFP
Download sequence
Identical sequences H3CMD0
ENSTNIP00000009411 99883.ENSTNIP00000009411 ENSTNIP00000009411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]