SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009417 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009417
Domain Number 1 Region: 1813-2070
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-52
Family Ankyrin repeat 0.0000000573
Further Details:      
 
Domain Number 2 Region: 1144-1282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-16
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 3 Region: 466-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000607
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 4 Region: 869-1000
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 5 Region: 767-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000016
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 6 Region: 269-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000123
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 542-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000136
Family EGF-type module 0.005
Further Details:      
 
Domain Number 8 Region: 504-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000176
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 9 Region: 618-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000234
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 10 Region: 643-776
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 301-470
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000135
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 12 Region: 996-1034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000084
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 13 Region: 580-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 151-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000194
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 805-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 16 Region: 188-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000594
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 17 Region: 1513-1544
Classification Level Classification E-value
Superfamily Notch domain 0.000000115
Family Notch domain 0.0019
Further Details:      
 
Domain Number 18 Region: 1434-1466
Classification Level Classification E-value
Superfamily Notch domain 0.000000458
Family Notch domain 0.0011
Further Details:      
 
Domain Number 19 Region: 1388-1435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000571
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 1475-1508
Classification Level Classification E-value
Superfamily Notch domain 0.000000759
Family Notch domain 0.0074
Further Details:      
 
Domain Number 21 Region: 114-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family EGF-type module 0.011
Further Details:      
 
Domain Number 22 Region: 64-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000287
Family EGF-type module 0.011
Further Details:      
 
Domain Number 23 Region: 1034-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000055
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 24 Region: 27-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000597
Family EGF-type module 0.02
Further Details:      
 
Domain Number 25 Region: 228-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 26 Region: 1277-1312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000768
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009417
Domain Number - Region: 1325-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00182
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1358-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00215
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 1125-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0108
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 1072-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009417   Gene: ENSTNIG00000006640   Transcript: ENSTNIT00000009588
Sequence length 2433
Comment pep:known_by_projection chromosome:TETRAODON8:1:14178619:14200512:-1 gene:ENSTNIG00000006640 transcript:ENSTNIT00000009588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPVCRPGSPAPCVGPGLCGAPQGGALQCMDDKAPCVNNATCVTLSNGTEYCRCAPGFLGE
YCQHKDPCQPGYCLNGGNCSVSTSAGVPVPGSATCSCPLGYTGQHCQSPQNSTCYPNNPC
ANRGVCTLLPFNKYKCECARGWTGTGCEYEDKCLSSPCANGGTCSSVSGGSFTCSCPPGY
AGARCLNDTNECAATPSICQNEGGCINTPGSYKCVCTPGFTGKHCESSYIPCSPSPCLNG
GTCHQTSETSYSCHCLPAGPGFNGTNCENNIDDCPGNQCANGGTCIDGVNTYNCQCPPEW
TGQHCTEDVNECRLQPNTCQNGGTCSNLLGSYVCVCVNGWSGSDCSENIDDCATAACSHG
STCEDRVASFVCHCPYGKTGLLCHLNDACISNPCRGGSKCDTNPITGMFNCNCPPGYTGI
TCNIDRDECSIAGTNPCEHDGQCVNTEGSFTCNCAKGYTGPRCEQDVNECASNPCQNDGT
CLDRIGVYTCICMPGFEGPHCQIEINECLSSPCLNRGKCLDQVNRFVCECPAGFSGETCQ
INIDECSSTPCLNGAKCIDLPNGYDCECAEGFQGQLCEENINDCVPEPCHHGKCKDGIAT
FSCECQPGYTGAICNVQVQECHSNPCQNRGRCIDLVNAYQCNCPPGITGVNCEINEDDCA
SNLCEFGECQDGINEYKCVCSPGYTGDKCDVEINECSSNPCKSGGTCVDKVNGFHCLCPP
STHGLLCLSGTDQCANQPCIHGQCIEQQYSYFCQCEAGWMGQHCEQEKNECLPNPCLNGG
SCLDRHNGYTCTCQLGFSGVNCEKNINECASEPCLNQGTCVDGLNSYTCLCSPPFTANCT
IYMATNMIIICQRGGVCLPSNDYTSYTCRCPAGWQGEQCSEDVNECKKNPCRNGGHCMNS
PGSYTCKCPLGYSGHNCQTDIDDCSPNPCLNGGSCVDDVGSFSCKCRPGFEGEHCEEEVD
ECASQPCSNGAICRDYVNSFVCECQPGFDGILCNHNILECTESSCLNNGTCIDDINTFFC
RCRPGFFGTFCENEQNECESQPCINGGTCTDGLGTYRTCPARYSGQNCQNYVNLCRQVRC
HNGGSCSHTGPTTWTCHCQTWTGLYCDVPNMSCQDFAARKGLEVENVCKNAGRCVNVENF
HKCECQPGYTGSYCEEMIDECKSNPCRNGATCKDYQSTYECLCKPGYQGVNCEYEVDECH
SKPCLHGGTCINLINKFTCICPPGTHGVQCEVNVDDCAPNSGSWEPRCLNGGQCVDGIGR
YTCSCPPGFVGEHCEGDLNECLSGPCHSPGSLDCVQLVNDYQCRCRLGYTALFLQTPGRH
CDSMVDLCLSKPCRNGGVCTMNTTSVHGFMCSCSPIARNGGRCVESTAGQLYCQCQQGFS
GAHCENSQRCMLPCKNGGTCVRDSANPFQYSCHCPINFSGRYCEINVLRTGPSTCPYIQC
KQQSGDTVCDDQCNNYECQWDGGDCSLNWKQPWMNCTAGVACWDFFKNGRCDKECDTAGC
LFDGFECQESSACKYEKYCADHYGNGICDGSCNTEACGWDGLDCASNTPAKIVPGTLVIV
VQLQPKELLVDLTGFIRFLGALLHTNLQVKVDENKKPMVYPYFGAEEDHGHQARRSRSKR
EVEKEVIGSFVYLEIDNRKCSESPGECFSNIDEAASFIAAARIKDGLPYPLVSVNSRYMD
PPPPTNYVPYLVGVSVVIILLILVLGMLAAKRKHKHGVLWLPDGFMTNKNDKRREPVGQD
DFDLKNFKTQDGGVMDSGQSQRWLEDEVPSRKPRLEGKPLLPLPMDGAIDRREWTLQHRK
AADISLTPPQAELDSDGLDVNVKGPGRVYPLMLASLRNGGVPDCNLHGDEEEESGGDEPG
SSVISDLISQGASLIAQTDRTGETALHLAARYARADAAKRLLDAGADPNAHDNMGRTPLH
AAVAADAQGVFQILIRNRATELDSRMNDGTTPLILAARLAVEGMVEELIHCHADINAVDD
HGKSALHWAAAVNNVEATLVLLKNGANRDMQDNKEETPLFLAAREGSFEAAQVLLDHYSN
RDITDHMDRLPRDTAQERMHHDIVRLLDQYNVVHSPHNGLISWVEREPLHGFMAVRPGPQ
GKKSRRGGGGAKVGGVGGGAKELKDMKSKRRKKPRGTAGALPESSVTMSPVDSLESPHSY
LGEVSGTVSTTANSPPLLSSPSTRPMLPPVSHMLGQQQGWVGMTKHPYNDHMFSLIPHQM
GASHPGLGHSRGPMLTPMNVTVSREVPPIVTFQMMAPGGGQGLLKQSQAGQVQVTQSQSH
SQPGPAHLHCAQSMMYQMPEQMSIGHGLPHTAPHPQTLGHGHGAMEGQSRQLPSYPPMQS
PVDKYPTPPSQHSYTTNGSEGTTPGHSAHPPSEHPYLTPSPDSPDPWSSSSPHSNSDWSD
ITTSPTPLGNPHHTLPSSHHTHIPEQVQLQPQA
Download sequence
Identical sequences H3CMD6
ENSTNIP00000009417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]