SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009443 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009443
Domain Number 1 Region: 298-480
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.35e-34
Family Phospholipase D 0.051
Further Details:      
 
Domain Number 2 Region: 671-876
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.53e-30
Family Nuclease 0.036
Further Details:      
 
Domain Number 3 Region: 64-189
Classification Level Classification E-value
Superfamily PX domain 0.000000000759
Family PX domain 0.012
Further Details:      
 
Domain Number 4 Region: 200-309
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000149
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 5 Region: 611-665
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000345
Family Phospholipase D 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009443   Gene: ENSTNIG00000006664   Transcript: ENSTNIT00000009616
Sequence length 1018
Comment pep:known_by_projection chromosome:TETRAODON8:10:9462580:9471129:1 gene:ENSTNIG00000006664 transcript:ENSTNIT00000009616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLVESLDTRELDIGDGEDIDYDGSPGDCRIPFSAVYATVGFKEANARVYLPTVHITAR
ILEVERFIAAQNRSKLSVFKIEMKHGEFTWLIKRKEKHFMELHREATYKTLMRFPLPSRS
HTVRRRTVRKSEVTEMPSLPRGGGDDLVRDEQVSSRKRQLEDYLNKLLRMAMYRKYYHTM
EFIDVSQLSFIHDLGPKGLEGLIYKRSGGHRIPGMNCCGQNQVCYRWSKRWLVVKDSCLI
YMKPDSGAISFVLLLDKEFTIKMDSKETETKHGVRIDSLSSARPGDRTLVFKCSSYRHAR
WWGQSIESFVRDHGKAFLRVHRFGSFAQEQENIPAKWYVNGKTYMEDVADALEEAKEEIF
ITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFVMLYKEVELALGINSGYSKRT
LSHLHSNIKVMRHPDHVSSSVYLWAHHEKIIVIDQSVAFVGGIDLAYGRWDDREHRLTDV
GSVTRSVAAEQVGAVRANSPPSKGVLHVDGVSESNGQGTPSGDQAEPAKLKGIGRNRRTR
FSLYRHLQRHAMQHADSADSVDSTGSGSVRSLKTDVGELQGNTRFWHGKDYCNFVYKDWI
QLEKPFDDFIDRYTTPRMPWHDISAVVHGRAARDVARHFIQRWNFTKIMKPKYRSLSYPF
LLPKSHSTASELRYQVPECVSARVQVLRSAADWSAGIKYHEESIHNAYIQVIAKSKHYIY
IENQFFISCAENRLVYNKIGDAIIERIIRAHKEGKKYRVYVVTPLLPGFEGDITTGGGNA
IQAVMHFNYRTMIRGDYSIISQLKKEMDDQWMNYISFAGLRTHAELEGRLVTELIYVHSK
MLIADDNTVIIGSANINDRSMLGKRDSEVAVIVEDSEKVPGVMDGQEYEAGAYALQFASS
ASGGRTILGGHTDTSIDLTDPISDRFYKEVWMTTAGRNATIYEKVFRCLPTSLVRNMSEL
EQYQSSPGLAQTDQARAQEELRKIRGFLVQFPLDFLSEQNLMPSVGTKEAMVPTEIWT
Download sequence
Identical sequences H3CMG2
ENSTNIP00000009443 99883.ENSTNIP00000009443 ENSTNIP00000009443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]