SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009452 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009452
Domain Number 1 Region: 6-192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-36
Family SPRY domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009452   Gene: ENSTNIG00000006673   Transcript: ENSTNIT00000009625
Sequence length 198
Comment pep:novel chromosome:TETRAODON8:Un_random:87612145:87613047:-1 gene:ENSTNIG00000006673 transcript:ENSTNIT00000009625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPTCRADLIKHWVNLTLDDKTANKMLWITEGGAKVARMTDSVTCPVLDRPERYEYVPQVL
CKEGILGFRGYWEVEFTGWVVLGVAYERAARRNSDGPCGFGENEESWGLGWSGSSYNAWH
KSQTMEILEVPLCSTLGVYLDQPAGLLNFYTVEEVKEGEEGAGGKEVKLLHQVKSSFLGK
MIPGFWLGTQSHCLIKKK
Download sequence
Identical sequences H3CMH1
99883.ENSTNIP00000009452 ENSTNIP00000009452 ENSTNIP00000009452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]