SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009474 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009474
Domain Number 1 Region: 1213-1487
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.74e-55
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 239-486,514-579
Classification Level Classification E-value
Superfamily L domain-like 1.53e-46
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 3 Region: 605-796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-17
Family G proteins 0.0053
Further Details:      
 
Domain Number 4 Region: 29-193
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000065
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 1512-1757
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000061
Family WD40-repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009474   Gene: ENSTNIG00000006693   Transcript: ENSTNIT00000009648
Sequence length 1986
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:30314511:30342174:-1 gene:ENSTNIG00000006693 transcript:ENSTNIT00000009648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEMGARTSLFEVSEHGSVLPSPTLENIQAAYEDKQVEVARELIQQACCVECSAGVPRVGG
VNLLCLAVENGDQQSVRYLLKEARVPVPQELCETNPAILAANSGHPNLVKELLDSVPGPC
LRIDLLNWMLAKSCQHGHLDVVRLLVQRYHADVRDFAIHSDDFAVINGLPLYAAAQADNE
AVAQFLLQNGAGFSSYMLMDHPAFSQHLLRLRIQEEPTVDGKQTVSVCWSNLQLPWLELD
WFMDLSSRIVHLDLSSNCLVALPSVLPWGLIQLHTLDLSNNLLKELPAASTSQEVICTRL
RQVNLSQNQLASLPSGFLHLKHIQRVSAAKNQLQTLFDIPISTNWIGLRNLQELDVSDNC
LTSLPTAVMHCLKSLSVLNVCRNRLSGVPDPWACPLKQYKASNNEIESLPDTISIFWRTH
LQEVDFSENCLKELPSYIFELEALVSLRLTGNHIVTLPATSKWKCSQLKTLDLSRNQLGK
TQEVPKTRRLAFLTTRSRRDPDPVCSLEFPMILRDSLEVLYLNDNQLDYVPQSICGLHSL
TELYLSNNAGIRELPPELGQLSNLWQLDIENLTITNVPQEIRKEEGSVSVLAFLRAQLRK
AEHFRRLKMLVIGPPRQGKTALLEVLQTGKAAPFTAAECSISTSTWELDNPNGGKNKDSV
TFSVWDIGGSASMSTVNQCFFTDKALFLVVWNLALGQEAVANLQTWLLNIEARAPNSAVV
IVGTHLDLIDTNFRTERLATLRAHIFALCRSPSGARATGYPDITWKHLHEVSCKTLEGVD
GLKKLIYQVASSMKDNSNTVFGNKLLGRLIPRSYLTLQKAVVAEKQKRAAQGEVQYLTES
QLQIIVEQDTGSDIRDYEDLQTAINFLIESGSLLHFPDTSHGLCTLYFLCPVWLSECLER
ITHLKSSHSVARNGVIQAEDLKMLLVGTGFTRQNEEQYFQFLAKFEIALPVANNSYLLPH
LLPHKPAVDLHGLRQQTNNTLQRLIKMSFVPAGFWERFIARMLISLKEMDLQSFEPKRYT
KNARSKPSALYTFAGTQQKNRCSTFRVRRSQTIYWKEGLLVTFDGGYLSVESSDICWKRK
KSGGIRIICQSDMRDFSAMAFITDHVHALIEQWFPALTATESDGSLLVEQYAPCPICASL
GHQKPAENDGGHVHYFNMEDCVLAAVENEHISCPQHVEKPVLLQELVPELFMTDFPARLF
LEKAQLEYSEEEPHILGQGGSGTVIYQAQYGGQPVAIKRFHFKKCQKRTDVALDTMVKHL
QSADAYRSFTDFRQEAAMLRSLQHPCIVYLVGINIHPLCFALQLAPLGSLNTVLEGKHKG
SSYMPLGHMLTFKVAYQIAAGLAYLHRKSIIFCDLKSDNILVWSLEEQEAVNVKLSDYGI
SRHSFHEGVLGVEGTPGYQAPEVRPGIVYDEKVDMFSYGMVLYELLTGRRPSLGHHQLQI
AKKLSKGIRPLLGNPEEVQFFCLQTLLTECWDTKPEKRPLAVQCLRQMQQPSFPCLRYVL
SCDSHSQLFLSPLQGHSAVFWSGDKDSSRNYSVVNVEKGKMEVKRMPCPGSRISCQMKMG
STLWMATEDQEVFIYSLKDMCPLSHPQKLLSCPAIVTCLCLVPEREKNLARVFAGMSDGL
VAVYSLLDGLPVEGEAYLCSHTLNKTMFGLKDSDPRQKPYPVKSMVLVGSGSQLWFSNGP
GVLVLDCWSLCALRRLEPYVAPSSVVSMTASFTPWDEEAVWMLDDHVNMLLFYHATSFQL
CAKYCCGDSNPLRDVFAIQREVATATAAEVKATEQEDKLEYWKSGDVTVMYAKEAGTQII
QRQESVTDYCSISSECSLELPGSDASSMAALGSPVSTCSVSPLADLQDASGNPGQKAPCP
PEPDQDCAGPERPPCRRRRAFTVLSVNRTLWIPRREGDVLVIELQSCSNQLRGRVIAVLS
PPSYSSLGILQEAALVAHDTVVCGFLKPDMEWSLCVWRGWGSHELEVFYKSYEELGRLET
DMRRRR
Download sequence
Identical sequences H3CMJ3
ENSTNIP00000009474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]