SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009556 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009556
Domain Number 1 Region: 46-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 796-975
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.91e-37
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 352-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-30
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 4 Region: 982-1186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-30
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 5 Region: 160-350
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-25
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 6 Region: 590-648
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000314
Family Fibrinogen C-terminal domain-like 0.0052
Further Details:      
 
Domain Number 7 Region: 561-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000108
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009556   Gene: ENSTNIG00000007970   Transcript: ENSTNIT00000009731
Sequence length 1313
Comment pep:known_by_projection chromosome:TETRAODON8:15:1407246:1428186:-1 gene:ENSTNIG00000007970 transcript:ENSTNIT00000009731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTVIPSPVYSSISAERKPAVLKPELRPSLLCDWLTEECDGTLLSNLPPSSFRSSSQLSGS
HAPGFAKLNRRDGAGGWSPLSSDRYQWLEVDLGQRTEVTAVATQGRYGSSDWLTSYLLMF
SDTGHNWKQHRQEDSLGSFPGNSNADSVVQYKLQQPVVARFLRLIPLGWNPNGRIGLRLE
AYGCPYTSDVVSLDGSSGLTFRLDPQPRRTSADIPSVPSVLSVLSVQFKTTRSSGVLLQA
AGGGGPGLSLELHRGQLQLLLLQGTAPCFVTKTVVWASLGSLLDDQHWHRVVVVWRSSRL
NLTVDKHTETVQVPPELGRRSILELNVGAVQESEQPNKSFRGCLENLLYNKLNLIQLAKR
GAQQVSVVGNVTFSCAEPVSVAVTFPGPRSFLQLPGATASSSGGTAVGFQFRTWNEAGLL
LTFALAGEGGVAWLYLSEARLRLQIHRAGRVLLQLSAGSALSDGQWHTVELSSRPGRLAV
SVDGDEEGAAHPSSFIAEGPLFFGGCPAEGETQACRNTFGVFQGCMRLLSVGAQPVDFMT
VQQRLLGNYSQLQIDMCGITDRCSPSPCEHGGRCSQSWTGFRCNCSGSGYSGATCHSSAY
ERSCEAYKHAGGTSGLFYIDVDGSGPIRPQLVYCNMTEENTWMEIQHNNTELTRLRPTPG
RNQLSLHFDFFTEEEQLTAAISQSEHCEQELSYRCRKSRLLNTPEGSPFSWWLGGRSPGR
LRSYWGGAQPGSQQCACGLRGDCVDPQHYCNCDADRTEWAEDSGLLTHKESLPVRSLVLG
DIWRPESEAAYRVGPLRCHGDKNFWNAAFFDKETSYLHFPTFHGELSADISFLFKTTASS
GVFLENLGIKDFIRIELSSSSQVLFSLDVGNGPLEVHVDSAVPLNDNRWHRVRAERNIKE
ASLQLDDLAPATQEAPTDGHFHLQLNSQLFIGGTASRQKGFRGCIRSLQLNGAPLDLEER
ARITPGVRPGCPGHCGSYGSFCQNHGRCLERHAGFRCDCARSAYAGVFCQTEVSASFQSG
TSVSYSFQEPLDSPRNSSLVPSPTQPEVSARGENVSLSFRTFQNPVLLLYVSSFSREFLA
LLINNDHLELCFRLDGRREAEVLRSRAGNLADGRLHHVSVGRLSASVWLQVDEEAVEEFN
LTSVGDLGAIKSLVLGRVQDPEGLDPEVARVASLGFTGCLSAVRFNAISPLKAALLHPDS
SPVVVTGPLLRSSCGSSASARPSAAEDAPRPPDRSGSLGAGQPLVNAVRTDSALVGGIIA
VAILVTAASLAAAAGFLYRRKEACQEPDGKAVKLEDGPDSQKTSEENRKEYFI
Download sequence
Identical sequences H3CMS5
ENSTNIP00000009556 99883.ENSTNIP00000009556 ENSTNIP00000009556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]