SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009570 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009570
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 6.41e-21
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 462-550,583-659
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000143
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 230-298
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000311
Family Ankyrin repeat 0.0045
Further Details:      
 
Domain Number 4 Region: 794-842
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000131
Family MYND zinc finger 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009570   Gene: ENSTNIG00000006783   Transcript: ENSTNIT00000009745
Sequence length 842
Comment pep:known_by_projection chromosome:TETRAODON8:1:21501173:21504911:1 gene:ENSTNIG00000006783 transcript:ENSTNIT00000009745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYEGEFMNGLKHGKGKYTWTTGEYYEGLFYKDYCHGEGFYCWPSGHKFTGKFFLNRKEGY
GHHLFPDGTSFQGLYQLDHRFGPGVMSYPNGCMDVGLWVGKHLHKLCDVAEESFSLQDFP
EYAAYVDPRAPVQLDLLSERRSAEDHSLLLTGKSGELDGVPLGDLREADVYQGEPGPGSS
LTLQARMETHIHKHRLAAETLSWDVGAVLALNRDGFGPKGPLEAMSEQLIQRASHGDLQA
VSKIIRTGLVHPDVADSRGNTALIVATVNYHHDVLHLLLDVGADIDKLNGEGMSALAVCH
LLYYPFRHLPAVFMPAPGKTQVRFHLMPFFFFLSDICRMDFAGFVSLKCVSCQILESPEI
SQADPPKPDPALSSQGCLSEQYGDAVIIVLAHVQALFCGLDRSKTPSDTKRFRVEEKDAK
EREIQSRSDQACEFRESEGKREGIECEEAGREAGKEKREVYLNTLKLLLKRGADPNTSRT
PVPVLFSAILACDREGIRRLLLLGARTDIPLPPKSKGLYPLHVAAALPGPAGPEITEMLL
HTVQDPDARAYDQDETFDLDKKTTTVKVKSKCLQVYMKAQWGRDESTELKEGGRTALHVA
CQRAGDHQNATKVVALLLSHRASTDLLWSGHSPLSLAIATGNILAVEELLNGGADPNTPL
GPGVGSALCAFANIHYTLDDRKETLLQMLVRAGADILMPVLVDGDVGTAMDYAYHSFHQD
VRISGTPFNALSPQEQELFKARCRLLCMMGDLMRQAAHQRELENLAEKERRVSLSYSERS
QTFAIFSRGLNVLEMKTVPKFCYYCGRSVLVRLTPCYRCYKVFYCSRPCRLRAWDELHKN
EC
Download sequence
Identical sequences H3CMT9
ENSTNIP00000009570 ENSTNIP00000009570 99883.ENSTNIP00000009570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]