SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009575 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009575
Domain Number 1 Region: 373-514
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.12e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 329-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000129
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 3 Region: 228-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000113
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 166-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000235
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009575
Domain Number - Region: 501-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000802
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009575   Gene: ENSTNIG00000006788   Transcript: ENSTNIT00000009750
Sequence length 683
Comment pep:known_by_projection chromosome:TETRAODON8:19:5365637:5371182:-1 gene:ENSTNIG00000006788 transcript:ENSTNIT00000009750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IILFTLSEILLGNEFDFTTVDECCQDGRNRGNNGHDCTIIPAFSSSYTCRIAQEQCCSAA
KETHLCLNGVIMALGQGACEVPYFEGEPWEAKLSKICCDCCTLGLMTARDTSSCNFNHLL
LNSQCSDTAKACCINKTMEELQTGPVLAQPKVNDTANPSVDCTVRGNSPCSHFCLDNNTC
GCFRGFQLQNDGVNCEDINECLAGTHNCFGNLVCINTEGSFLCQRRSNCGSGFELKFDNT
CQDLDECILGIHNCGADHLCVNTPGSFQCYPGNTCPAGFTEDAADSCTDVNECVAHSSPC
LPGETCVNTEGSFVCRKNTVTCGRGYHLSQDGTRCEDVNECQTGNVCGNHSCFNLVGAYR
CECRKGFFFNDGTKRCEDVNECRYYQGLCAHNCENTVGSYRCSCAAGFQLSYDGVNCEDV
DECLARPCGQNCANVYGSYRCYCHHGYQLSDTDRMTCEDVDECAQRSGGHTCSYSCSNVP
GSYYCTCPPTGYILAPNGQTCLDIDECAAGIHTCSATDSCFNIQGGFRCLSFSCPANFYE
VARGSRDDPSVSLRCMKHCHPNNLACNLEPVHLITYTCLSLPTFRDLTQPEDIIYLQTST
AFKTSTRHHATDIFFEILSADVQSFEAQKRAHQGMIIGVIQQVKPIIGPADLVLQVAINY
VQSGVISHRNIVFIHIFISDHLG
Download sequence
Identical sequences H3CMU4
ENSTNIP00000009575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]