SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009600 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009600
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.15e-29
Family TATA-box binding protein (TBP), C-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 93-181
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 6.75e-22
Family TATA-box binding protein (TBP), C-terminal domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009600   Gene: ENSTNIG00000006808   Transcript: ENSTNIT00000009775
Sequence length 185
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:88276217:88278710:-1 gene:ENSTNIG00000006808 transcript:ENSTNIT00000009775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESNNEGELDIIISNVVATFRTRCHLNLRTIALEGNNVIYKPEQGTVTMKLRKPRITANI
WSSGKIICTGASSEDEAKMGARRLARCLQKLGFKVSFSAFKVVNVMATCAMPFKISLIDF
TKRNRPIATYEPELHPAAMYTMRHPKATVKVFATGSVTILGPSVDNVAAAVQHVYPLLSE
CRRPL
Download sequence
Identical sequences Q4RR88
99883.ENSTNIP00000009600 99883.ENSTNIP00000019419 ENSTNIP00000009600 ENSTNIP00000019419 ENSTNIP00000009600 ENSTNIP00000019419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]