SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009628 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009628
Domain Number 1 Region: 41-152
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-34
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 2 Region: 164-275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-26
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009628   Gene: ENSTNIG00000006836   Transcript: ENSTNIT00000009803
Sequence length 275
Comment pep:novel chromosome:TETRAODON8:18:7472633:7475946:-1 gene:ENSTNIG00000006836 transcript:ENSTNIT00000009803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMEKLLIFLFVLMTGVCIGLVAIYFTGEANSTTNVEGPDSGCGSPQDLSEESGTFSSMNY
PNNYDDGKTCSWHITVDPDKVIHLWFEDFDLEETQLCMRDFITLQDSLGIIGKYCGGVKP
RSLVSLTNRLTVYFNTNDMTNKRGFKAYYKAVAPELTSEIVEAGGLLQGDQGSVMTPGFP
EQNYKDGALYQWRITVPKGQRVRLTFTSFDLVPEVCGDFVQVFDDYTAGSSSLDKGKFCG
KKKPKPVESSGNVMVVRFKSDHRLVSTGFSANYSS
Download sequence
Identical sequences H3CMZ7
ENSTNIP00000009628 99883.ENSTNIP00000009628 ENSTNIP00000009628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]