SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009644 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009644
Domain Number 1 Region: 154-268
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-35
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-35
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 295-417
Classification Level Classification E-value
Superfamily TIMP-like 1.08e-30
Family Netrin-like domain (NTR/C345C module) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009644   Gene: ENSTNIG00000006851   Transcript: ENSTNIT00000009819
Sequence length 417
Comment pep:known_by_projection chromosome:TETRAODON8:20:794617:798666:-1 gene:ENSTNIG00000006851 transcript:ENSTNIT00000009819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGGRVSLMLFILFTYHTPSQHPNERRPTFECGGHLVTDSGIVASEGFPTPYKPNSKCTW
YITVPEGHVVMMSFRLFDLEADPTCRYDYLDIYNGHSRLVQKLGRFCGTFRPGALISTSN
TMMLEMVSDEATGGRGFLAYFSAGKPHMEEDQFCGGRLTKTHGSVKTPNWPNSNYPAGIS
CSWHISVPPSNVIEVKFEKLDLEPDTYCRYDYVALFNGGETDNSRRIGKFCGDRAPGVIV
TNGNELLVQFVSDLSITSDGFLAHYSSVPRGTRTPTSTGDFIYGPQTTSIPQKPTNPLCT
QPCKRTGTLQSSYCPHDFVITGKVTAVLPGPSSAKVEVSLIKNYKPGRLSVTKSGPATSV
TLTSTCKRCPGLTKGLNYVLMGGVDAQGNGVLTPASFTLLYKPVHAKALAALSRKAC
Download sequence
Identical sequences H3CN13
ENSTNIP00000009644 99883.ENSTNIP00000009644 ENSTNIP00000009644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]