SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009666 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009666
Domain Number 1 Region: 8-45
Classification Level Classification E-value
Superfamily UBA-like 0.0000485
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009666   Gene: ENSTNIG00000006870   Transcript: ENSTNIT00000009841
Sequence length 168
Comment pep:known_by_projection chromosome:TETRAODON8:8:1831225:1832460:1 gene:ENSTNIG00000006870 transcript:ENSTNIT00000009841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHDHMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDISAALSDFEQLRQVHAGNLTFSS
TEDRAYPLPDKEMARVGRPLLHRQSEVVQAATEKRLSRGISHASSTIVSLARSHVSNTGG
PSSEPLLDMPVCTFQLPDLTVYREDFRSFIERDLIEQSMMVALEHAGE
Download sequence
Identical sequences Q4SSY7
99883.ENSTNIP00000009666 ENSTNIP00000009666 ENSTNIP00000009666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]