SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009671 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009671
Domain Number 1 Region: 132-422
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.53e-54
Family Regulator of chromosome condensation RCC1 0.021
Further Details:      
 
Domain Number 2 Region: 781-885
Classification Level Classification E-value
Superfamily POZ domain 9.73e-21
Family BTB/POZ domain 0.013
Further Details:      
 
Domain Number 3 Region: 543-659
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000228
Family BTB/POZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 25-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000205
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009671   Gene: ENSTNIG00000006874   Transcript: ENSTNIT00000009847
Sequence length 1369
Comment pep:known_by_projection chromosome:TETRAODON8:8:1918954:1929781:1 gene:ENSTNIG00000006874 transcript:ENSTNIT00000009847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMNLAAPQCTTKCRSHEHAGEVVAAVTRGSEGQLRLFLSLHCHNAAILRDRFGRTTLHMA
ASMGKKALLEWLLETKNSDLTVKDKESGWTALHRSAFYGQIHCLISLVKRGGLLSTLDKE
GLSVLDITMKDRPSHVVFKTADPTEVYTWGNNTNFSLGHGNQESRQHPELVDVFARTGVY
IKQVVLCKFHSVFLSQKGQVFTCGHGQGGRLGHGDEQTYLVPRMVEGLTSHHCSQIAAAK
DHTVVLTEEGYVYTFGLNTFHQLGLSPPPASAYVPKQVFSKTLKGRTVVGVAAGRFHTVL
WTREAVYTMGLNGGQLGYLLDPNGEKCVTAPRQVSALHHKDVTIAMAAASDGATVVVTEK
GDMYLLTEYQCKKIASRQLNIKKILVSGGGLNHRAAPQILNDGGGEKVDILALDEAGRVF
CWRSCNSSVRQCRWAYGRQVFMADAALSKNGMMFVTQEGEGFSGVWAGEYKKYGEKKDNS
VHILQKVSVEVCGHSDAGTVFERIRLEKLPHVHRAVSVTMDSKGRNFGVLQSDPKANLCE
IPTISPSSFLKHFGQLLEEADEMDVIHDVTLQAGDRTFAAHKYILSMRSEFFRKLLASEH
CGIGEELRGEARKSEDAVGCDLIVLENIPAEMLEYALDFIYTDSCELLVHKAKPRIPVAQ
KGQTKESNEERLISSLQDLNVRGRSALEVYRSLPTAAKEDDKAKSKNAKPGKKAKGGKGD
KAEVNAGGPNPVKTLQTVAKKLGLGSLSARRLDGVKYESGRINVVNRKSGSKPKFNQKKC
SFLHDVTLKSEDGKEFPCHKCVLCARLEYFNSMLGNPWIEATSCTALEMPTSSEILQAIL
EFIYTDESPTIKESLNVEFVCSVLVVADQLLITRLKEMCEVVITENLTLKNAAELLEFAT
IYNAEQLKLSCFQFIVLNITALLELKALDILSDEVLVELSAAYRRTIPAMQRRLITPYID
APDLRAYEDDDLDSVFTSKAKVELDQSCREIQFKKAKIKAKKKPRRRSDSSGGYTLSDII
QSPPAAVISPSMMKSEKVNSNESLQELLTSDSEGSCMGVGSPRDIQSPVFRDKTEDEKPF
THKLETPPSTPPVLKDSLSLRQISAPKTIPKVPPRTSSVCLWFSNYSPACPPPVLDLRTI
MDMEANSLQSLTPKSPGSMKHFPGPTKLSQKQRKILAMANKEASVESNTSKPTQPVTPSK
SSGKAWAAPIQSPPVSCSFRALLEEEEERGRISSATPAPPARKVTFKCEEGSEPERPTGC
VSASTLFPKQTRLISDIHAVSISQPWVLGPVGSPPPSSAVTFASIVEEEKQQQAALIRSR
EKPLALIQIEERAIQDLLLHYNAHENPEELITVERSSRGPVATPTWKKH
Download sequence
Identical sequences H3CN40
ENSTNIP00000009671 ENSTNIP00000009671 99883.ENSTNIP00000009671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]