SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009684 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009684
Domain Number 1 Region: 15-282
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-74
Family Eukaryotic proteases 0.00000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009684   Gene: ENSTNIG00000006887   Transcript: ENSTNIT00000009860
Sequence length 284
Comment pep:known_by_projection chromosome:TETRAODON8:18:7468473:7469726:-1 gene:ENSTNIG00000006887 transcript:ENSTNIT00000009860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRQLIYFHFPDWPSSCGKPAIPPSIMSRIVNGEQARPHSWPWQVSMQVWPASRPEPTFFH
TCGGTLIHRNWVLTAAHCFIRYADELQRWRMCLGKHNLTYTEPSERCFSVSGIYRHEDFK
YPTVPSVEFDIALVRLDGDVIPSDEISYACLPSKEEVLPGGKKCYATGWGDETGDSLDPK
VAEALNQVALPVVPYETCKRMDYWWFQVKTSMICCGFTLPDDLKSVCQGDSGGPLVCQDT
LSAPWEVHGITSFGPVGCIMNKKPSVFTRSSAYIPWIENVIRKE
Download sequence
Identical sequences H3CN53
99883.ENSTNIP00000009684 ENSTNIP00000009684 ENSTNIP00000009684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]